Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2U626

Protein Details
Accession M2U626    Localization Confidence Low Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
181-200HKANMLSRVRQRTKRISGIFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12.5, cyto_mito 11.5, cyto 9.5, nucl 5
Family & Domain DBs
Amino Acid Sequences MCVAELCVTVLPCKHRWYHLVRPCTPSSNLSTCGKKLGISGWEVKCNHCPYCHGHVSEFEYKLIGDGPAPPVGSLSGLARAHSTSLNAARRDIRLDNITRTDSATSVGSKSSLVTAASEKNRAMNSRLDAYFFPSPDSPYPAVREDDTESNPGGSPSETSVSDYSSVRHASISMPAGAETHKANMLSRVRQRTKRISGIFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.33
3 0.39
4 0.46
5 0.53
6 0.57
7 0.63
8 0.63
9 0.66
10 0.65
11 0.63
12 0.57
13 0.5
14 0.48
15 0.42
16 0.42
17 0.4
18 0.41
19 0.37
20 0.38
21 0.35
22 0.29
23 0.25
24 0.25
25 0.23
26 0.22
27 0.3
28 0.28
29 0.35
30 0.35
31 0.36
32 0.39
33 0.41
34 0.39
35 0.32
36 0.33
37 0.33
38 0.4
39 0.43
40 0.38
41 0.35
42 0.36
43 0.41
44 0.44
45 0.39
46 0.3
47 0.25
48 0.23
49 0.22
50 0.19
51 0.12
52 0.07
53 0.07
54 0.09
55 0.1
56 0.1
57 0.1
58 0.09
59 0.09
60 0.09
61 0.08
62 0.06
63 0.1
64 0.11
65 0.11
66 0.11
67 0.11
68 0.12
69 0.12
70 0.12
71 0.09
72 0.15
73 0.19
74 0.19
75 0.21
76 0.22
77 0.22
78 0.25
79 0.23
80 0.2
81 0.19
82 0.21
83 0.21
84 0.22
85 0.22
86 0.19
87 0.19
88 0.17
89 0.13
90 0.12
91 0.11
92 0.09
93 0.08
94 0.08
95 0.08
96 0.07
97 0.07
98 0.07
99 0.07
100 0.06
101 0.07
102 0.08
103 0.13
104 0.14
105 0.16
106 0.16
107 0.18
108 0.19
109 0.2
110 0.21
111 0.2
112 0.21
113 0.24
114 0.24
115 0.23
116 0.22
117 0.26
118 0.26
119 0.22
120 0.21
121 0.17
122 0.2
123 0.19
124 0.24
125 0.21
126 0.2
127 0.23
128 0.23
129 0.25
130 0.22
131 0.24
132 0.22
133 0.24
134 0.24
135 0.23
136 0.21
137 0.2
138 0.2
139 0.17
140 0.15
141 0.11
142 0.1
143 0.1
144 0.12
145 0.12
146 0.15
147 0.15
148 0.15
149 0.17
150 0.17
151 0.15
152 0.17
153 0.18
154 0.15
155 0.15
156 0.14
157 0.13
158 0.18
159 0.19
160 0.16
161 0.15
162 0.15
163 0.15
164 0.15
165 0.16
166 0.13
167 0.12
168 0.14
169 0.14
170 0.15
171 0.23
172 0.28
173 0.35
174 0.43
175 0.52
176 0.58
177 0.66
178 0.74
179 0.76
180 0.79
181 0.8