Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2U8B7

Protein Details
Accession M2U8B7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
301-328AGTITRDPRKVERKKPGHVKARKMPTWVHydrophilic
NLS Segment(s)
PositionSequence
299-330RRAGTITRDPRKVERKKPGHVKARKMPTWVKR
Subcellular Location(s) mito 18.5, cyto_mito 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020568  Ribosomal_S5_D2-typ_fold  
IPR014721  Ribosomal_S5_D2-typ_fold_subgr  
IPR000754  Ribosomal_S9  
IPR020574  Ribosomal_S9_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00380  Ribosomal_S9  
PROSITE View protein in PROSITE  
PS00360  RIBOSOMAL_S9  
Amino Acid Sequences MAGRELSRSMWRAFDALGSRPLPQCQRAIRPAQRSLHPQIRRCISTTAARHAEVTEDEVREPFKAAPEFDFDGIKGSGEEGEKKNILRTLRVVPASPSYFSAKPTFTDDFLSLSALLRKVATLPTIPPAEAPKVAWKTIEQYRIMTNEPVKTARYHRMLQILRRLNCIHPSLMPEEVLQAMQRYKKPVQPGDIKPKPGVIDELGRAKGVGRRKTSSAVAWLVEGEGEVLVNGKSLSQFFGRLHHRESAVWALKATQRLDKYNVFALVQGGGLTGQAEAMTLAVAKSLLVHEPALKPALRRAGTITRDPRKVERKKPGHVKARKMPTWVKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.24
4 0.29
5 0.27
6 0.3
7 0.31
8 0.36
9 0.36
10 0.36
11 0.4
12 0.41
13 0.49
14 0.53
15 0.61
16 0.64
17 0.66
18 0.71
19 0.7
20 0.68
21 0.67
22 0.69
23 0.68
24 0.67
25 0.65
26 0.66
27 0.67
28 0.64
29 0.59
30 0.53
31 0.48
32 0.49
33 0.48
34 0.48
35 0.44
36 0.42
37 0.39
38 0.37
39 0.35
40 0.27
41 0.27
42 0.22
43 0.2
44 0.2
45 0.2
46 0.2
47 0.19
48 0.2
49 0.15
50 0.17
51 0.18
52 0.19
53 0.2
54 0.24
55 0.26
56 0.25
57 0.25
58 0.19
59 0.2
60 0.19
61 0.17
62 0.12
63 0.1
64 0.11
65 0.12
66 0.17
67 0.16
68 0.2
69 0.22
70 0.22
71 0.25
72 0.27
73 0.27
74 0.24
75 0.26
76 0.27
77 0.31
78 0.32
79 0.3
80 0.28
81 0.32
82 0.31
83 0.28
84 0.25
85 0.24
86 0.23
87 0.25
88 0.26
89 0.21
90 0.21
91 0.26
92 0.25
93 0.21
94 0.23
95 0.21
96 0.19
97 0.19
98 0.18
99 0.12
100 0.11
101 0.13
102 0.11
103 0.1
104 0.09
105 0.08
106 0.09
107 0.09
108 0.1
109 0.09
110 0.09
111 0.13
112 0.14
113 0.14
114 0.14
115 0.15
116 0.16
117 0.15
118 0.15
119 0.19
120 0.2
121 0.21
122 0.2
123 0.18
124 0.22
125 0.27
126 0.31
127 0.24
128 0.24
129 0.25
130 0.27
131 0.27
132 0.25
133 0.22
134 0.19
135 0.19
136 0.19
137 0.18
138 0.19
139 0.22
140 0.26
141 0.28
142 0.28
143 0.28
144 0.36
145 0.37
146 0.39
147 0.44
148 0.44
149 0.41
150 0.42
151 0.41
152 0.34
153 0.35
154 0.33
155 0.25
156 0.18
157 0.19
158 0.18
159 0.17
160 0.16
161 0.12
162 0.11
163 0.1
164 0.09
165 0.07
166 0.07
167 0.08
168 0.12
169 0.13
170 0.18
171 0.2
172 0.23
173 0.3
174 0.33
175 0.38
176 0.43
177 0.5
178 0.55
179 0.57
180 0.56
181 0.5
182 0.48
183 0.42
184 0.33
185 0.28
186 0.18
187 0.17
188 0.17
189 0.21
190 0.19
191 0.18
192 0.17
193 0.16
194 0.18
195 0.23
196 0.28
197 0.29
198 0.31
199 0.34
200 0.37
201 0.38
202 0.36
203 0.33
204 0.28
205 0.23
206 0.2
207 0.18
208 0.15
209 0.12
210 0.1
211 0.06
212 0.04
213 0.03
214 0.03
215 0.04
216 0.03
217 0.04
218 0.04
219 0.04
220 0.05
221 0.06
222 0.08
223 0.08
224 0.11
225 0.11
226 0.19
227 0.25
228 0.27
229 0.3
230 0.32
231 0.32
232 0.3
233 0.33
234 0.35
235 0.33
236 0.3
237 0.27
238 0.26
239 0.28
240 0.32
241 0.31
242 0.28
243 0.27
244 0.31
245 0.36
246 0.36
247 0.36
248 0.35
249 0.35
250 0.29
251 0.26
252 0.23
253 0.18
254 0.15
255 0.12
256 0.08
257 0.06
258 0.06
259 0.06
260 0.05
261 0.04
262 0.04
263 0.04
264 0.04
265 0.04
266 0.04
267 0.04
268 0.04
269 0.04
270 0.04
271 0.04
272 0.05
273 0.06
274 0.08
275 0.09
276 0.1
277 0.14
278 0.15
279 0.18
280 0.21
281 0.21
282 0.21
283 0.25
284 0.34
285 0.31
286 0.3
287 0.35
288 0.4
289 0.44
290 0.52
291 0.56
292 0.56
293 0.6
294 0.63
295 0.67
296 0.68
297 0.74
298 0.75
299 0.76
300 0.76
301 0.82
302 0.89
303 0.89
304 0.89
305 0.88
306 0.88
307 0.87
308 0.89
309 0.83
310 0.8