Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2U8B3

Protein Details
Accession M2U8B3   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MGKRHNRKRTRSRPRNRNNNNNNNNHNNPHydrophilic
NLS Segment(s)
PositionSequence
3-16KRHNRKRTRSRPRN
Subcellular Location(s) mito 15, nucl 10.5, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MGKRHNRKRTRSRPRNRNNNNNNNNHNNPNANNNLNINTTPIHIRSESVSTASSTLSPTSSCFQPSGCPLANVPANHWQQTYTAWQMRLRIQREQEQELELETQRLRIFGGLPEDERCLMEPMLKVVTDLFDGFYDYEDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.96
2 0.96
3 0.95
4 0.95
5 0.95
6 0.95
7 0.93
8 0.91
9 0.88
10 0.85
11 0.8
12 0.72
13 0.65
14 0.58
15 0.5
16 0.47
17 0.45
18 0.38
19 0.34
20 0.32
21 0.3
22 0.27
23 0.26
24 0.21
25 0.17
26 0.16
27 0.16
28 0.15
29 0.16
30 0.14
31 0.15
32 0.15
33 0.17
34 0.16
35 0.15
36 0.14
37 0.12
38 0.13
39 0.12
40 0.11
41 0.09
42 0.09
43 0.08
44 0.07
45 0.09
46 0.11
47 0.11
48 0.12
49 0.11
50 0.11
51 0.12
52 0.14
53 0.17
54 0.15
55 0.15
56 0.13
57 0.16
58 0.19
59 0.17
60 0.18
61 0.22
62 0.23
63 0.23
64 0.23
65 0.2
66 0.18
67 0.2
68 0.21
69 0.18
70 0.2
71 0.21
72 0.22
73 0.24
74 0.3
75 0.36
76 0.36
77 0.36
78 0.37
79 0.43
80 0.46
81 0.47
82 0.42
83 0.35
84 0.32
85 0.28
86 0.26
87 0.19
88 0.17
89 0.13
90 0.14
91 0.13
92 0.13
93 0.12
94 0.11
95 0.12
96 0.12
97 0.17
98 0.16
99 0.18
100 0.19
101 0.21
102 0.21
103 0.2
104 0.19
105 0.17
106 0.15
107 0.17
108 0.17
109 0.17
110 0.19
111 0.18
112 0.16
113 0.14
114 0.15
115 0.13
116 0.13
117 0.11
118 0.1
119 0.11
120 0.11