Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2TJF4

Protein Details
Accession M2TJF4   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MNQGKGPSKPHHKKNKDDKKKINCYACSKEHydrophilic
NLS Segment(s)
PositionSequence
6-21GPSKPHHKKNKDDKKK
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences MNQGKGPSKPHHKKNKDDKKKINCYACSKEGHIARNYLSKNKAYNNNKTLLDKYNTLWHLRSDIDFYQIETTQRLPTYTHITANITSTSTTQGTETTRVYHRPRVRMTTAQLTTQTREELDGAHSTLKACLSANGYANARSMQWQKTTTDIDKKSLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.91
3 0.91
4 0.92
5 0.92
6 0.92
7 0.94
8 0.92
9 0.9
10 0.86
11 0.83
12 0.8
13 0.74
14 0.67
15 0.59
16 0.57
17 0.52
18 0.5
19 0.44
20 0.39
21 0.36
22 0.39
23 0.39
24 0.38
25 0.37
26 0.34
27 0.36
28 0.41
29 0.49
30 0.49
31 0.57
32 0.55
33 0.56
34 0.55
35 0.53
36 0.5
37 0.45
38 0.41
39 0.33
40 0.3
41 0.32
42 0.31
43 0.31
44 0.28
45 0.23
46 0.22
47 0.21
48 0.21
49 0.17
50 0.16
51 0.17
52 0.16
53 0.16
54 0.16
55 0.16
56 0.16
57 0.13
58 0.14
59 0.12
60 0.12
61 0.12
62 0.11
63 0.12
64 0.18
65 0.18
66 0.18
67 0.17
68 0.18
69 0.18
70 0.19
71 0.17
72 0.11
73 0.1
74 0.09
75 0.11
76 0.1
77 0.09
78 0.08
79 0.1
80 0.11
81 0.13
82 0.13
83 0.14
84 0.16
85 0.22
86 0.26
87 0.33
88 0.37
89 0.42
90 0.46
91 0.49
92 0.52
93 0.51
94 0.52
95 0.53
96 0.48
97 0.43
98 0.43
99 0.39
100 0.36
101 0.32
102 0.28
103 0.19
104 0.19
105 0.17
106 0.13
107 0.14
108 0.13
109 0.13
110 0.13
111 0.13
112 0.13
113 0.14
114 0.13
115 0.11
116 0.1
117 0.12
118 0.14
119 0.17
120 0.18
121 0.21
122 0.22
123 0.22
124 0.23
125 0.22
126 0.19
127 0.21
128 0.24
129 0.25
130 0.29
131 0.3
132 0.3
133 0.36
134 0.42
135 0.43
136 0.48
137 0.47