Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2T8K4

Protein Details
Accession M2T8K4    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
40-61LDTAIRRKSRKRRYVRTEEALTHydrophilic
80-99RGERRYGRYKQTRHNARTCAHydrophilic
NLS Segment(s)
PositionSequence
45-52RRKSRKRR
Subcellular Location(s) nucl 13, mito 11, cyto_nucl 10
Family & Domain DBs
Amino Acid Sequences RVRNFPRSSTSSLDEKITQLSKIYKIVLLREKVGSLKVALDTAIRRKSRKRRYVRTEEALTISKVGSSCGDDKSALKRVRGERRYGRYKQTRHNARTCAVEVDSASNRSDSND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.32
3 0.33
4 0.29
5 0.25
6 0.23
7 0.24
8 0.24
9 0.25
10 0.25
11 0.22
12 0.22
13 0.28
14 0.32
15 0.31
16 0.3
17 0.29
18 0.29
19 0.27
20 0.26
21 0.21
22 0.14
23 0.13
24 0.11
25 0.1
26 0.09
27 0.1
28 0.11
29 0.17
30 0.23
31 0.25
32 0.27
33 0.36
34 0.47
35 0.56
36 0.64
37 0.68
38 0.72
39 0.79
40 0.87
41 0.85
42 0.81
43 0.73
44 0.64
45 0.56
46 0.47
47 0.37
48 0.27
49 0.19
50 0.13
51 0.1
52 0.1
53 0.08
54 0.09
55 0.1
56 0.11
57 0.12
58 0.12
59 0.14
60 0.18
61 0.26
62 0.27
63 0.27
64 0.33
65 0.41
66 0.51
67 0.54
68 0.57
69 0.58
70 0.65
71 0.73
72 0.71
73 0.73
74 0.72
75 0.75
76 0.76
77 0.78
78 0.79
79 0.78
80 0.81
81 0.75
82 0.68
83 0.67
84 0.58
85 0.51
86 0.42
87 0.35
88 0.28
89 0.29
90 0.29
91 0.25
92 0.24
93 0.21