Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2A8Z3

Protein Details
Accession B2A8Z3   
Localization Confidence Low
Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
150-169APTMNNSQERKRRENRKIMSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR007648  ATPase_inhibitor_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0042030  F:ATPase inhibitor activity  
GO:0032780  P:negative regulation of ATP-dependent activity  
KEGG pan:PODANSg10061  -  
Pfam View protein in Pfam  
PF04568  IATP  
Amino Acid Sequences MLRTSFTKVARPALFSRSFAITSRAMAAGDTGAPPKTGGQGDAFQRREKAQEDFAIRQREKEKLIALRQKLREQQDHLQKLSDHMSVVRLYYTLELPVLMYSKTATRSPRSRVASTTKYLSTRLITTRSSRLGCQTPICPATSSLNEIMAPTMNNSQERKRRENRKIMS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.4
3 0.4
4 0.34
5 0.34
6 0.3
7 0.3
8 0.23
9 0.21
10 0.22
11 0.19
12 0.16
13 0.14
14 0.14
15 0.1
16 0.1
17 0.1
18 0.09
19 0.09
20 0.09
21 0.1
22 0.1
23 0.13
24 0.12
25 0.13
26 0.14
27 0.18
28 0.24
29 0.32
30 0.34
31 0.32
32 0.33
33 0.33
34 0.34
35 0.32
36 0.3
37 0.25
38 0.29
39 0.32
40 0.35
41 0.4
42 0.46
43 0.43
44 0.44
45 0.43
46 0.41
47 0.37
48 0.35
49 0.34
50 0.31
51 0.39
52 0.42
53 0.44
54 0.48
55 0.5
56 0.52
57 0.54
58 0.52
59 0.49
60 0.47
61 0.5
62 0.52
63 0.52
64 0.48
65 0.43
66 0.38
67 0.35
68 0.32
69 0.25
70 0.15
71 0.11
72 0.12
73 0.11
74 0.11
75 0.09
76 0.07
77 0.06
78 0.07
79 0.07
80 0.06
81 0.05
82 0.05
83 0.05
84 0.06
85 0.06
86 0.05
87 0.05
88 0.05
89 0.07
90 0.1
91 0.13
92 0.16
93 0.22
94 0.28
95 0.33
96 0.41
97 0.45
98 0.44
99 0.46
100 0.5
101 0.49
102 0.46
103 0.45
104 0.39
105 0.35
106 0.35
107 0.32
108 0.26
109 0.25
110 0.25
111 0.25
112 0.24
113 0.27
114 0.31
115 0.34
116 0.34
117 0.32
118 0.34
119 0.36
120 0.36
121 0.36
122 0.32
123 0.33
124 0.33
125 0.33
126 0.29
127 0.26
128 0.28
129 0.26
130 0.29
131 0.23
132 0.23
133 0.22
134 0.21
135 0.19
136 0.16
137 0.14
138 0.12
139 0.16
140 0.18
141 0.22
142 0.26
143 0.35
144 0.42
145 0.49
146 0.57
147 0.63
148 0.71
149 0.76