Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2TT16

Protein Details
Accession M2TT16    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
89-115DDGFFNPGKERKKPKKKDPDPEPDAGABasic
NLS Segment(s)
PositionSequence
65-106KKRADERRERAERQKAKEEESKKKDDGFFNPGKERKKPKKKD
Subcellular Location(s) nucl 14.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MSPPPNGKTKHHCPGRDGWVGDISPGNCVQSADGTHCKTHEIPCTQGCGKYHLASQEACRKCVGKKRADERRERAERQKAKEEESKKKDDGFFNPGKERKKPKKKDPDPEPDAGAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.68
3 0.66
4 0.57
5 0.49
6 0.44
7 0.4
8 0.36
9 0.31
10 0.23
11 0.18
12 0.17
13 0.16
14 0.12
15 0.12
16 0.11
17 0.1
18 0.11
19 0.14
20 0.19
21 0.21
22 0.21
23 0.21
24 0.23
25 0.23
26 0.26
27 0.29
28 0.26
29 0.28
30 0.28
31 0.34
32 0.32
33 0.33
34 0.29
35 0.26
36 0.25
37 0.23
38 0.23
39 0.19
40 0.2
41 0.18
42 0.21
43 0.26
44 0.25
45 0.25
46 0.24
47 0.24
48 0.25
49 0.34
50 0.37
51 0.35
52 0.42
53 0.52
54 0.61
55 0.67
56 0.73
57 0.71
58 0.74
59 0.75
60 0.72
61 0.71
62 0.71
63 0.71
64 0.69
65 0.72
66 0.63
67 0.61
68 0.64
69 0.64
70 0.64
71 0.63
72 0.64
73 0.56
74 0.59
75 0.58
76 0.55
77 0.52
78 0.5
79 0.48
80 0.47
81 0.54
82 0.55
83 0.55
84 0.59
85 0.64
86 0.67
87 0.73
88 0.78
89 0.81
90 0.87
91 0.92
92 0.94
93 0.94
94 0.93
95 0.89
96 0.83