Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2SN82

Protein Details
Accession M2SN82   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
113-133KNWISRWLARNPDCRRKKQKKHydrophilic
NLS Segment(s)
PositionSequence
127-133RRKKQKK
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR006600  HTH_CenpB_DNA-bd_dom  
Pfam View protein in Pfam  
PF03221  HTH_Tnp_Tc5  
PROSITE View protein in PROSITE  
PS51253  HTH_CENPB  
Amino Acid Sequences MSQRFGTYAEIEERIEIAIAELDSGIHANVRAAADYNHVPYSRLQKRVSGRASKMDRAAPNRRLNQQQEDALKAYITRCDALYMPPLMPQLISAAQRILDLEHSDGKAPPIGKNWISRWLARNPDCRRKKQKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.1
4 0.08
5 0.07
6 0.07
7 0.06
8 0.06
9 0.06
10 0.06
11 0.06
12 0.06
13 0.04
14 0.05
15 0.05
16 0.07
17 0.07
18 0.08
19 0.08
20 0.09
21 0.12
22 0.13
23 0.16
24 0.16
25 0.15
26 0.16
27 0.18
28 0.28
29 0.31
30 0.36
31 0.34
32 0.39
33 0.44
34 0.52
35 0.56
36 0.53
37 0.49
38 0.52
39 0.55
40 0.51
41 0.48
42 0.45
43 0.42
44 0.42
45 0.48
46 0.47
47 0.5
48 0.52
49 0.54
50 0.55
51 0.54
52 0.52
53 0.47
54 0.43
55 0.37
56 0.34
57 0.31
58 0.25
59 0.21
60 0.16
61 0.13
62 0.11
63 0.11
64 0.09
65 0.08
66 0.1
67 0.1
68 0.11
69 0.14
70 0.13
71 0.12
72 0.13
73 0.13
74 0.12
75 0.11
76 0.1
77 0.09
78 0.11
79 0.12
80 0.11
81 0.11
82 0.11
83 0.11
84 0.11
85 0.1
86 0.09
87 0.09
88 0.11
89 0.14
90 0.14
91 0.15
92 0.15
93 0.16
94 0.18
95 0.18
96 0.18
97 0.2
98 0.25
99 0.27
100 0.33
101 0.35
102 0.41
103 0.42
104 0.45
105 0.45
106 0.48
107 0.54
108 0.55
109 0.62
110 0.63
111 0.71
112 0.75
113 0.81