Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2V9P9

Protein Details
Accession M2V9P9    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
47-74NPNTALEKIKKKRREKESKRHQAQEWLYHydrophilic
NLS Segment(s)
PositionSequence
54-66KIKKKRREKESKR
Subcellular Location(s) mito 21, nucl 5
Family & Domain DBs
Amino Acid Sequences KKALVIPASHTNILARHQIQYYAYYRIRPQCSSTYNTRAISHHREINPNTALEKIKKKRREKESKRHQAQEWLYRDSPCEQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.23
3 0.22
4 0.22
5 0.24
6 0.23
7 0.26
8 0.26
9 0.27
10 0.27
11 0.26
12 0.3
13 0.36
14 0.39
15 0.36
16 0.38
17 0.37
18 0.39
19 0.41
20 0.42
21 0.4
22 0.41
23 0.41
24 0.39
25 0.34
26 0.36
27 0.38
28 0.35
29 0.35
30 0.33
31 0.37
32 0.36
33 0.41
34 0.37
35 0.3
36 0.28
37 0.25
38 0.25
39 0.25
40 0.33
41 0.36
42 0.44
43 0.54
44 0.63
45 0.7
46 0.79
47 0.85
48 0.86
49 0.89
50 0.91
51 0.93
52 0.92
53 0.9
54 0.82
55 0.8
56 0.77
57 0.76
58 0.69
59 0.65
60 0.58
61 0.51
62 0.51