Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2B2G7

Protein Details
Accession B2B2G7    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
128-158MYQKLQKDRRAQEKKQKDPKKVPLRNKFAVPHydrophilic
NLS Segment(s)
PositionSequence
136-152RRAQEKKQKDPKKVPLR
173-188RKAKGLKVKEKGLKVE
Subcellular Location(s) mito 13, nucl 11.5, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR013025  Ribosomal_L25/23  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pan:PODANSg7205  -  
Pfam View protein in Pfam  
PF00276  Ribosomal_L23  
Amino Acid Sequences MSSMNSLPRIAEPVQRWKRFGEKQLFLPNHVVALLRPKPKQSPHLATFAVPLQFNKLDLRDYLHHAYGVETTAIRSFINQPKPERKNKTGPWYRPRAQKMMIAELVKPFVWPEPVKDEEALKPWDHAMYQKLQKDRRAQEKKQKDPKKVPLRNKFAVPDDVKSVSQQARELLRKAKGLKVKEKGLKVEGKEEGEKGEVKDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.51
3 0.52
4 0.51
5 0.59
6 0.6
7 0.64
8 0.63
9 0.57
10 0.61
11 0.7
12 0.67
13 0.6
14 0.56
15 0.47
16 0.37
17 0.32
18 0.25
19 0.15
20 0.23
21 0.27
22 0.29
23 0.31
24 0.34
25 0.41
26 0.46
27 0.54
28 0.54
29 0.56
30 0.53
31 0.58
32 0.54
33 0.48
34 0.44
35 0.39
36 0.32
37 0.23
38 0.2
39 0.18
40 0.18
41 0.18
42 0.18
43 0.16
44 0.15
45 0.15
46 0.2
47 0.18
48 0.23
49 0.25
50 0.23
51 0.23
52 0.21
53 0.22
54 0.17
55 0.16
56 0.11
57 0.08
58 0.08
59 0.08
60 0.08
61 0.07
62 0.08
63 0.14
64 0.2
65 0.28
66 0.32
67 0.37
68 0.46
69 0.53
70 0.62
71 0.63
72 0.62
73 0.64
74 0.67
75 0.72
76 0.71
77 0.74
78 0.72
79 0.73
80 0.72
81 0.71
82 0.68
83 0.61
84 0.54
85 0.48
86 0.42
87 0.38
88 0.35
89 0.27
90 0.24
91 0.2
92 0.19
93 0.16
94 0.14
95 0.1
96 0.07
97 0.11
98 0.1
99 0.12
100 0.16
101 0.18
102 0.19
103 0.2
104 0.21
105 0.19
106 0.22
107 0.23
108 0.17
109 0.16
110 0.15
111 0.15
112 0.14
113 0.14
114 0.13
115 0.18
116 0.24
117 0.28
118 0.34
119 0.39
120 0.44
121 0.52
122 0.57
123 0.61
124 0.65
125 0.69
126 0.73
127 0.79
128 0.84
129 0.86
130 0.86
131 0.85
132 0.85
133 0.88
134 0.88
135 0.87
136 0.87
137 0.86
138 0.87
139 0.81
140 0.75
141 0.69
142 0.61
143 0.61
144 0.53
145 0.44
146 0.4
147 0.39
148 0.34
149 0.31
150 0.32
151 0.27
152 0.26
153 0.25
154 0.25
155 0.3
156 0.34
157 0.37
158 0.38
159 0.39
160 0.43
161 0.45
162 0.48
163 0.47
164 0.51
165 0.57
166 0.58
167 0.64
168 0.66
169 0.68
170 0.66
171 0.66
172 0.65
173 0.58
174 0.58
175 0.53
176 0.5
177 0.47
178 0.43
179 0.38
180 0.34
181 0.34