Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2UEQ3

Protein Details
Accession M2UEQ3    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
35-57SADPTGENRRRRRRRISDGEINEHydrophilic
NLS Segment(s)
PositionSequence
43-49RRRRRRR
Subcellular Location(s) plas 5extr 5, nucl 4, E.R. 4, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences MTTSLFTSTLMISFLVVAAPHILPCPVDPRTLADSADPTGENRRRRRRRISDGEINEDYLSEERRRRQLIEEKLAAKRECPVPKPGGLIGQVLGVHEEDQKEQQPSIVQRVEKAICRPWGKTGEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.06
4 0.06
5 0.07
6 0.07
7 0.07
8 0.07
9 0.08
10 0.08
11 0.09
12 0.14
13 0.13
14 0.14
15 0.14
16 0.19
17 0.23
18 0.23
19 0.23
20 0.19
21 0.19
22 0.19
23 0.19
24 0.15
25 0.12
26 0.2
27 0.26
28 0.33
29 0.41
30 0.52
31 0.6
32 0.69
33 0.79
34 0.8
35 0.84
36 0.86
37 0.85
38 0.84
39 0.78
40 0.76
41 0.65
42 0.56
43 0.45
44 0.34
45 0.26
46 0.17
47 0.15
48 0.11
49 0.14
50 0.16
51 0.21
52 0.23
53 0.24
54 0.3
55 0.37
56 0.41
57 0.45
58 0.46
59 0.45
60 0.46
61 0.5
62 0.43
63 0.35
64 0.31
65 0.32
66 0.32
67 0.31
68 0.34
69 0.32
70 0.34
71 0.36
72 0.33
73 0.29
74 0.25
75 0.23
76 0.17
77 0.16
78 0.14
79 0.12
80 0.11
81 0.08
82 0.08
83 0.09
84 0.1
85 0.1
86 0.13
87 0.17
88 0.18
89 0.18
90 0.19
91 0.23
92 0.25
93 0.31
94 0.34
95 0.3
96 0.3
97 0.37
98 0.39
99 0.38
100 0.4
101 0.39
102 0.42
103 0.45
104 0.46
105 0.46