Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2UE97

Protein Details
Accession M2UE97   
Localization Confidence High
Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
38-60DDRPRVKRGENERRDRRKKEESSBasic
NLS Segment(s)
PositionSequence
6-74ERPKARRISVTEKERPSGRRPEADRPRTRDRGDDRPRVKRGENERRDRRKKEESSGLKGLFGGLKKRIA
Subcellular Location(s) nucl 24, mito 3
Family & Domain DBs
Amino Acid Sequences MSKPEERPKARRISVTEKERPSGRRPEADRPRTRDRGDDRPRVKRGENERRDRRKKEESSGLKGLFGGLKKRIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.72
3 0.72
4 0.65
5 0.64
6 0.62
7 0.59
8 0.55
9 0.55
10 0.51
11 0.5
12 0.52
13 0.59
14 0.65
15 0.71
16 0.72
17 0.69
18 0.73
19 0.71
20 0.67
21 0.64
22 0.59
23 0.6
24 0.61
25 0.63
26 0.61
27 0.63
28 0.66
29 0.62
30 0.59
31 0.55
32 0.58
33 0.6
34 0.63
35 0.65
36 0.73
37 0.8
38 0.87
39 0.85
40 0.83
41 0.82
42 0.79
43 0.77
44 0.77
45 0.74
46 0.72
47 0.74
48 0.66
49 0.56
50 0.49
51 0.42
52 0.35
53 0.3
54 0.27