Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2V9J2

Protein Details
Accession M2V9J2    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-33ITAQLARKRERNRESQRRSRQRVKDQIDALHydrophilic
NLS Segment(s)
PositionSequence
11-22KRERNRESQRRS
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00170  bZIP_1  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
Amino Acid Sequences MKPITAQLARKRERNRESQRRSRQRVKDQIDALERQNRELELDNRSLQKQLLHALEAIEVFEKGASLHQNSIVKQKVHI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.77
3 0.78
4 0.83
5 0.85
6 0.88
7 0.89
8 0.91
9 0.9
10 0.89
11 0.88
12 0.89
13 0.84
14 0.8
15 0.72
16 0.68
17 0.62
18 0.54
19 0.46
20 0.42
21 0.36
22 0.29
23 0.28
24 0.22
25 0.19
26 0.21
27 0.2
28 0.17
29 0.19
30 0.2
31 0.21
32 0.22
33 0.21
34 0.18
35 0.17
36 0.15
37 0.17
38 0.17
39 0.16
40 0.15
41 0.15
42 0.15
43 0.13
44 0.12
45 0.08
46 0.07
47 0.06
48 0.05
49 0.05
50 0.05
51 0.08
52 0.11
53 0.12
54 0.14
55 0.2
56 0.24
57 0.25
58 0.34
59 0.37