Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2VBB8

Protein Details
Accession M2VBB8    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
8-37VNVPKTRRTYCKGKDCKKHTQHKVTQYKAGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MLISVFQVNVPKTRRTYCKGKDCKKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKRAKTTKKVVLRLECTACKTKAQLALKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.49
3 0.58
4 0.61
5 0.69
6 0.74
7 0.79
8 0.82
9 0.82
10 0.87
11 0.86
12 0.87
13 0.87
14 0.87
15 0.85
16 0.85
17 0.88
18 0.8
19 0.79
20 0.73
21 0.68
22 0.6
23 0.54
24 0.43
25 0.35
26 0.33
27 0.33
28 0.31
29 0.28
30 0.33
31 0.37
32 0.41
33 0.46
34 0.5
35 0.47
36 0.53
37 0.6
38 0.58
39 0.59
40 0.58
41 0.57
42 0.55
43 0.57
44 0.48
45 0.43
46 0.4
47 0.33
48 0.35
49 0.36
50 0.36
51 0.3
52 0.38
53 0.42
54 0.51
55 0.57
56 0.6
57 0.61
58 0.65
59 0.71
60 0.7
61 0.69
62 0.65
63 0.62
64 0.6
65 0.57
66 0.51
67 0.47
68 0.46
69 0.4
70 0.34
71 0.31
72 0.31
73 0.35
74 0.41
75 0.43
76 0.46
77 0.56
78 0.63
79 0.68
80 0.66
81 0.6
82 0.55
83 0.51
84 0.49
85 0.49
86 0.5
87 0.51
88 0.54
89 0.52
90 0.49
91 0.49
92 0.42