Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2T1R3

Protein Details
Accession M2T1R3    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
156-181SSTDFDVVDRRRRRRCRGFDAWSIGVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito_nucl 10.5, mito 8.5, cyto 3.5, cyto_pero 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029070  Chitinase_insertion_sf  
IPR017853  Glycoside_hydrolase_SF  
Gene Ontology GO:0016787  F:hydrolase activity  
Amino Acid Sequences MKEIKKQFGRRHGSRLTLAPDYWYLRGSEPAEMQNYIDWVGSRVRLQTNITNIEKNLKPLWKMGCSFIPEKGGAAGSCNNLPGVLSNREIKRIIKEKRVGYDDAGTYAMKEAFANPYCLGGIITWSIDFDDFDVWLIDIDLSTIKFNSWPINVDISSTDFDVVDRRRRRRCRGFDAWSIGVNVVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.62
3 0.57
4 0.5
5 0.44
6 0.38
7 0.36
8 0.33
9 0.3
10 0.26
11 0.21
12 0.19
13 0.24
14 0.23
15 0.22
16 0.22
17 0.24
18 0.25
19 0.24
20 0.24
21 0.19
22 0.18
23 0.16
24 0.14
25 0.1
26 0.1
27 0.11
28 0.12
29 0.12
30 0.15
31 0.16
32 0.18
33 0.21
34 0.24
35 0.27
36 0.33
37 0.34
38 0.32
39 0.31
40 0.35
41 0.33
42 0.32
43 0.31
44 0.27
45 0.26
46 0.29
47 0.33
48 0.31
49 0.31
50 0.31
51 0.3
52 0.3
53 0.3
54 0.27
55 0.25
56 0.21
57 0.2
58 0.17
59 0.15
60 0.11
61 0.11
62 0.12
63 0.1
64 0.1
65 0.1
66 0.1
67 0.09
68 0.09
69 0.08
70 0.1
71 0.11
72 0.13
73 0.18
74 0.18
75 0.21
76 0.22
77 0.22
78 0.25
79 0.31
80 0.34
81 0.37
82 0.43
83 0.43
84 0.47
85 0.5
86 0.44
87 0.37
88 0.35
89 0.27
90 0.22
91 0.21
92 0.15
93 0.12
94 0.12
95 0.1
96 0.07
97 0.07
98 0.07
99 0.11
100 0.12
101 0.14
102 0.13
103 0.14
104 0.13
105 0.14
106 0.13
107 0.08
108 0.08
109 0.06
110 0.06
111 0.06
112 0.06
113 0.06
114 0.06
115 0.06
116 0.05
117 0.05
118 0.05
119 0.06
120 0.06
121 0.06
122 0.05
123 0.06
124 0.05
125 0.04
126 0.05
127 0.05
128 0.06
129 0.06
130 0.06
131 0.07
132 0.08
133 0.09
134 0.13
135 0.13
136 0.15
137 0.17
138 0.21
139 0.21
140 0.21
141 0.21
142 0.2
143 0.2
144 0.17
145 0.16
146 0.11
147 0.12
148 0.17
149 0.21
150 0.29
151 0.37
152 0.46
153 0.56
154 0.66
155 0.76
156 0.81
157 0.85
158 0.86
159 0.87
160 0.86
161 0.84
162 0.82
163 0.74
164 0.64
165 0.56