Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2SPP9

Protein Details
Accession M2SPP9    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
82-103RALWLVRRRRDERRTRPKAMESBasic
NLS Segment(s)
PositionSequence
89-99RRRDERRTRPK
Subcellular Location(s) mito 10.5, cyto_mito 9.833, cyto_nucl 8.833, nucl 8.5, cyto 8
Family & Domain DBs
Amino Acid Sequences MHPTQISSGLRGGAWGAKPALAHDSWWSGLCAVCVRVRHTTTDYVSKYTRTAVRDGPGDKTSARAGGQQRADSSARTADSERALWLVRRRRDERRTRPKAMESWQPRVGRPVAVPTRGGVATLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.15
4 0.15
5 0.15
6 0.16
7 0.19
8 0.14
9 0.15
10 0.14
11 0.16
12 0.16
13 0.17
14 0.16
15 0.13
16 0.13
17 0.13
18 0.12
19 0.11
20 0.13
21 0.14
22 0.17
23 0.22
24 0.23
25 0.26
26 0.27
27 0.3
28 0.3
29 0.36
30 0.34
31 0.32
32 0.32
33 0.29
34 0.27
35 0.26
36 0.28
37 0.22
38 0.23
39 0.22
40 0.24
41 0.27
42 0.27
43 0.27
44 0.24
45 0.23
46 0.2
47 0.19
48 0.17
49 0.14
50 0.13
51 0.15
52 0.16
53 0.21
54 0.23
55 0.22
56 0.22
57 0.24
58 0.25
59 0.2
60 0.19
61 0.15
62 0.14
63 0.14
64 0.15
65 0.14
66 0.15
67 0.15
68 0.14
69 0.13
70 0.13
71 0.15
72 0.22
73 0.28
74 0.33
75 0.41
76 0.47
77 0.55
78 0.65
79 0.73
80 0.77
81 0.8
82 0.83
83 0.82
84 0.83
85 0.79
86 0.75
87 0.7
88 0.69
89 0.65
90 0.64
91 0.63
92 0.59
93 0.53
94 0.52
95 0.48
96 0.41
97 0.35
98 0.38
99 0.37
100 0.37
101 0.37
102 0.32
103 0.35
104 0.31