Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2AVL5

Protein Details
Accession B2AVL5    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
17-40WKIPWRLSPTQKYRQRQRLKAVDKHydrophilic
77-103KYTIFDRKEKRYRKGIHKLPKWTRVSQHydrophilic
NLS Segment(s)
PositionSequence
84-96KEKRYRKGIHKLP
Subcellular Location(s) mito 22.5, cyto_mito 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG pan:PODANSg4801  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRATNSLSGGLLWKIPWRLSPTQKYRQRQRLKAVDKVVETLSTALAKKGETVKSLERWKAEMPTEAEMLAKDKYTIFDRKEKRYRKGIHKLPKWTRVSQRLNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.11
4 0.14
5 0.15
6 0.16
7 0.19
8 0.24
9 0.31
10 0.39
11 0.49
12 0.53
13 0.62
14 0.7
15 0.76
16 0.8
17 0.83
18 0.84
19 0.82
20 0.83
21 0.83
22 0.79
23 0.77
24 0.72
25 0.65
26 0.56
27 0.5
28 0.4
29 0.3
30 0.25
31 0.18
32 0.13
33 0.1
34 0.1
35 0.08
36 0.08
37 0.08
38 0.09
39 0.13
40 0.14
41 0.14
42 0.17
43 0.19
44 0.24
45 0.29
46 0.3
47 0.26
48 0.27
49 0.28
50 0.28
51 0.26
52 0.24
53 0.22
54 0.22
55 0.21
56 0.19
57 0.18
58 0.14
59 0.15
60 0.11
61 0.09
62 0.08
63 0.08
64 0.1
65 0.14
66 0.21
67 0.23
68 0.32
69 0.39
70 0.48
71 0.58
72 0.64
73 0.67
74 0.71
75 0.77
76 0.78
77 0.82
78 0.82
79 0.83
80 0.83
81 0.87
82 0.86
83 0.87
84 0.82
85 0.8
86 0.8
87 0.79
88 0.8
89 0.77
90 0.79