Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2V7Z9

Protein Details
Accession M2V7Z9    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
26-48LAVCLHKRWRVRQRRKRDALAASHydrophilic
NLS Segment(s)
PositionSequence
35-41RVRQRRK
Subcellular Location(s) extr 9, mito 8, cyto 3, nucl 2, pero 2, plas 1, E.R. 1, golg 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MIRDRAPTFVMVGALLTILPIGLSILAVCLHKRWRVRQRRKRDALAASGEGLGSGDAGKETAEGDRVQGGAAVMEKGQRFEGEQRSSSRDLVHESSTEIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.05
4 0.04
5 0.03
6 0.03
7 0.02
8 0.03
9 0.02
10 0.03
11 0.02
12 0.03
13 0.05
14 0.05
15 0.06
16 0.09
17 0.12
18 0.17
19 0.22
20 0.32
21 0.41
22 0.52
23 0.64
24 0.71
25 0.79
26 0.86
27 0.88
28 0.84
29 0.81
30 0.73
31 0.67
32 0.6
33 0.49
34 0.38
35 0.31
36 0.24
37 0.17
38 0.13
39 0.08
40 0.04
41 0.03
42 0.02
43 0.02
44 0.03
45 0.03
46 0.03
47 0.04
48 0.04
49 0.06
50 0.06
51 0.06
52 0.07
53 0.07
54 0.07
55 0.07
56 0.07
57 0.06
58 0.06
59 0.06
60 0.06
61 0.09
62 0.09
63 0.1
64 0.11
65 0.11
66 0.13
67 0.19
68 0.27
69 0.29
70 0.32
71 0.35
72 0.4
73 0.42
74 0.41
75 0.37
76 0.3
77 0.31
78 0.31
79 0.3
80 0.25