Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2T6T1

Protein Details
Accession M2T6T1    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
162-186DIGYGVKEKKKKTRRDRDSSVSHGHBasic
NLS Segment(s)
PositionSequence
169-176EKKKKTRR
Subcellular Location(s) cyto 11, nucl 8, mito 3, cysk 3
Family & Domain DBs
Amino Acid Sequences MDAAPNCAICNAPPYPECSCESERLQIAVKQAEQRAMDERLAEIRDWVINHARQHILNAFERLTSTRKQAHSSYLASLPHYEVYMRYSGHPPIHPMYVATLQTQIAEAHAELKRGIDADWRASVLRYPEVLDYFYSLVDLRLPDDHSREVVEPPFAAAGYTDIGYGVKEKKKKTRRDRDSSVSHGHMAVGRVARGPPPVPVPPPAPGQHVGFPRGAGPYPY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.29
4 0.31
5 0.32
6 0.35
7 0.36
8 0.38
9 0.39
10 0.37
11 0.36
12 0.36
13 0.32
14 0.33
15 0.32
16 0.32
17 0.31
18 0.31
19 0.34
20 0.32
21 0.32
22 0.32
23 0.31
24 0.28
25 0.23
26 0.22
27 0.21
28 0.22
29 0.19
30 0.15
31 0.14
32 0.15
33 0.15
34 0.17
35 0.2
36 0.22
37 0.24
38 0.27
39 0.28
40 0.26
41 0.29
42 0.29
43 0.27
44 0.25
45 0.26
46 0.22
47 0.2
48 0.21
49 0.2
50 0.2
51 0.18
52 0.21
53 0.25
54 0.27
55 0.31
56 0.32
57 0.35
58 0.36
59 0.36
60 0.34
61 0.3
62 0.29
63 0.26
64 0.25
65 0.2
66 0.16
67 0.14
68 0.12
69 0.08
70 0.1
71 0.11
72 0.11
73 0.12
74 0.14
75 0.17
76 0.19
77 0.2
78 0.21
79 0.21
80 0.21
81 0.19
82 0.17
83 0.16
84 0.16
85 0.16
86 0.13
87 0.12
88 0.11
89 0.11
90 0.12
91 0.09
92 0.06
93 0.06
94 0.05
95 0.09
96 0.1
97 0.1
98 0.09
99 0.1
100 0.1
101 0.1
102 0.1
103 0.09
104 0.1
105 0.11
106 0.12
107 0.12
108 0.12
109 0.12
110 0.13
111 0.11
112 0.11
113 0.1
114 0.1
115 0.11
116 0.12
117 0.12
118 0.11
119 0.11
120 0.1
121 0.09
122 0.09
123 0.07
124 0.07
125 0.07
126 0.07
127 0.07
128 0.08
129 0.11
130 0.12
131 0.15
132 0.15
133 0.15
134 0.16
135 0.17
136 0.17
137 0.16
138 0.16
139 0.13
140 0.12
141 0.12
142 0.1
143 0.09
144 0.06
145 0.06
146 0.06
147 0.06
148 0.06
149 0.06
150 0.06
151 0.06
152 0.09
153 0.14
154 0.2
155 0.25
156 0.31
157 0.42
158 0.51
159 0.62
160 0.71
161 0.76
162 0.81
163 0.85
164 0.88
165 0.87
166 0.85
167 0.81
168 0.76
169 0.66
170 0.57
171 0.47
172 0.39
173 0.32
174 0.26
175 0.23
176 0.18
177 0.16
178 0.17
179 0.17
180 0.18
181 0.2
182 0.19
183 0.18
184 0.22
185 0.26
186 0.27
187 0.31
188 0.32
189 0.31
190 0.37
191 0.36
192 0.36
193 0.35
194 0.35
195 0.38
196 0.39
197 0.38
198 0.33
199 0.31
200 0.28
201 0.28