Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2TJS6

Protein Details
Accession M2TJS6   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
214-239LRCWQLCRDTRTRKQSYSKLRKKPYLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10, cysk 7, mito 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MCALNIHTLHDDILYELLITCRDLISLKRLILTHSAIYHAFNNRRRLVLRAVFKTQSIVRLRYCTNNEHYLKEAHRYIVYMPPCNVIDRVALREALWPIVRQSMPSMISCEWALALHTRYSQAGLKHNELVFAKEAALTMLSTSLPLHFEQRTLFRAITQTYAASDTPEEAIELDEAIIQRLDPRLDAHKIWVEDFMHTYQTNRNGQKGLDLQLRCWQLCRDTRTRKQSYSKLRKKPYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.07
4 0.08
5 0.08
6 0.08
7 0.08
8 0.07
9 0.08
10 0.09
11 0.11
12 0.16
13 0.2
14 0.2
15 0.23
16 0.24
17 0.25
18 0.28
19 0.29
20 0.26
21 0.22
22 0.24
23 0.21
24 0.23
25 0.25
26 0.28
27 0.33
28 0.37
29 0.44
30 0.44
31 0.47
32 0.47
33 0.47
34 0.47
35 0.47
36 0.49
37 0.46
38 0.5
39 0.47
40 0.46
41 0.45
42 0.38
43 0.38
44 0.34
45 0.33
46 0.3
47 0.33
48 0.35
49 0.39
50 0.4
51 0.38
52 0.39
53 0.44
54 0.44
55 0.42
56 0.42
57 0.39
58 0.37
59 0.37
60 0.33
61 0.26
62 0.24
63 0.23
64 0.22
65 0.24
66 0.25
67 0.23
68 0.22
69 0.23
70 0.23
71 0.23
72 0.22
73 0.16
74 0.16
75 0.15
76 0.17
77 0.15
78 0.14
79 0.13
80 0.16
81 0.15
82 0.15
83 0.14
84 0.12
85 0.11
86 0.15
87 0.15
88 0.13
89 0.13
90 0.14
91 0.15
92 0.15
93 0.17
94 0.13
95 0.14
96 0.14
97 0.12
98 0.09
99 0.08
100 0.08
101 0.07
102 0.08
103 0.07
104 0.08
105 0.09
106 0.09
107 0.1
108 0.12
109 0.13
110 0.19
111 0.21
112 0.23
113 0.26
114 0.26
115 0.27
116 0.24
117 0.24
118 0.18
119 0.15
120 0.13
121 0.1
122 0.1
123 0.07
124 0.07
125 0.05
126 0.04
127 0.05
128 0.04
129 0.04
130 0.05
131 0.05
132 0.06
133 0.07
134 0.1
135 0.1
136 0.11
137 0.12
138 0.15
139 0.17
140 0.18
141 0.18
142 0.16
143 0.18
144 0.18
145 0.18
146 0.16
147 0.14
148 0.12
149 0.14
150 0.13
151 0.11
152 0.11
153 0.09
154 0.09
155 0.09
156 0.08
157 0.07
158 0.07
159 0.06
160 0.06
161 0.05
162 0.06
163 0.06
164 0.07
165 0.06
166 0.06
167 0.07
168 0.09
169 0.1
170 0.09
171 0.12
172 0.17
173 0.2
174 0.21
175 0.24
176 0.27
177 0.28
178 0.28
179 0.29
180 0.25
181 0.23
182 0.25
183 0.22
184 0.2
185 0.2
186 0.21
187 0.22
188 0.29
189 0.35
190 0.36
191 0.38
192 0.36
193 0.36
194 0.42
195 0.4
196 0.39
197 0.38
198 0.36
199 0.34
200 0.4
201 0.44
202 0.37
203 0.36
204 0.33
205 0.33
206 0.4
207 0.46
208 0.5
209 0.56
210 0.66
211 0.74
212 0.78
213 0.79
214 0.81
215 0.83
216 0.84
217 0.85
218 0.86
219 0.86