Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2U631

Protein Details
Accession M2U631    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MPKEKTTRKAAPKKTEKKKKVTDPNAPKRGLBasic
NLS Segment(s)
PositionSequence
5-22KTTRKAAPKKTEKKKKVT
Subcellular Location(s) nucl 22, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKEKTTRKAAPKKTEKKKKVTDPNAPKRGLSAYMFFANEQREKVREDNPGIKFGEVGKLLGEKWKALNDKQRQPYEAKAALDKKRYEQEKAAYTAADEEEEESE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.93
3 0.91
4 0.9
5 0.9
6 0.9
7 0.9
8 0.89
9 0.89
10 0.89
11 0.91
12 0.89
13 0.8
14 0.69
15 0.59
16 0.52
17 0.44
18 0.34
19 0.26
20 0.2
21 0.21
22 0.22
23 0.2
24 0.2
25 0.2
26 0.19
27 0.18
28 0.17
29 0.16
30 0.19
31 0.22
32 0.24
33 0.25
34 0.28
35 0.35
36 0.34
37 0.36
38 0.33
39 0.3
40 0.26
41 0.22
42 0.21
43 0.14
44 0.12
45 0.09
46 0.1
47 0.1
48 0.13
49 0.13
50 0.1
51 0.11
52 0.16
53 0.19
54 0.22
55 0.32
56 0.37
57 0.46
58 0.54
59 0.56
60 0.54
61 0.54
62 0.55
63 0.53
64 0.49
65 0.41
66 0.39
67 0.44
68 0.47
69 0.51
70 0.48
71 0.46
72 0.5
73 0.53
74 0.51
75 0.5
76 0.51
77 0.51
78 0.53
79 0.48
80 0.39
81 0.36
82 0.33
83 0.28
84 0.21
85 0.15