Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2TND3

Protein Details
Accession M2TND3    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
33-58VHKPTAAKIKKRQKYEEKKASRPVDKBasic
NLS Segment(s)
PositionSequence
38-55AAKIKKRQKYEEKKASRP
160-170TGGKKKKKGKK
Subcellular Location(s) mito 11.5, mito_nucl 11.333, nucl 10, cyto_nucl 8.333, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039914  SRP9-like  
IPR039432  SRP9_dom  
Gene Ontology GO:0048500  C:signal recognition particle  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Pfam View protein in Pfam  
PF05486  SRP9-21  
Amino Acid Sequences MPYFATSAEWYEQSSLLLKARPTTTRITSKYSVHKPTAAKIKKRQKYEEKKASRPVDKARDSSPQPQSQDVEEVTATFTLKTYDPESGTCLQYETNKGAEVGRLIGNLGRLGRHMAALPETTEDLSMPAGGEGAATPQVDEGGDVKMGGTAPDAKASAGTGGKKKKKGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.16
4 0.19
5 0.18
6 0.22
7 0.25
8 0.27
9 0.28
10 0.32
11 0.37
12 0.43
13 0.45
14 0.48
15 0.48
16 0.51
17 0.58
18 0.6
19 0.59
20 0.53
21 0.56
22 0.51
23 0.54
24 0.59
25 0.57
26 0.57
27 0.61
28 0.69
29 0.7
30 0.76
31 0.79
32 0.79
33 0.82
34 0.84
35 0.85
36 0.83
37 0.83
38 0.85
39 0.83
40 0.77
41 0.72
42 0.7
43 0.68
44 0.64
45 0.59
46 0.53
47 0.52
48 0.5
49 0.53
50 0.51
51 0.47
52 0.44
53 0.44
54 0.42
55 0.36
56 0.34
57 0.25
58 0.19
59 0.14
60 0.12
61 0.1
62 0.09
63 0.08
64 0.06
65 0.06
66 0.06
67 0.06
68 0.08
69 0.09
70 0.1
71 0.11
72 0.11
73 0.15
74 0.15
75 0.16
76 0.14
77 0.13
78 0.12
79 0.13
80 0.15
81 0.13
82 0.12
83 0.11
84 0.12
85 0.12
86 0.11
87 0.1
88 0.1
89 0.08
90 0.08
91 0.08
92 0.08
93 0.08
94 0.09
95 0.09
96 0.07
97 0.07
98 0.09
99 0.09
100 0.09
101 0.09
102 0.09
103 0.1
104 0.11
105 0.11
106 0.1
107 0.1
108 0.1
109 0.09
110 0.08
111 0.07
112 0.07
113 0.07
114 0.06
115 0.05
116 0.05
117 0.04
118 0.04
119 0.04
120 0.05
121 0.06
122 0.06
123 0.06
124 0.06
125 0.07
126 0.06
127 0.07
128 0.07
129 0.07
130 0.07
131 0.07
132 0.07
133 0.08
134 0.08
135 0.07
136 0.08
137 0.1
138 0.11
139 0.14
140 0.14
141 0.13
142 0.13
143 0.14
144 0.16
145 0.16
146 0.21
147 0.27
148 0.37
149 0.46
150 0.54