Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2TH52

Protein Details
Accession M2TH52    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-22RSEHCVRHRRSHTNEKPFKCKFBasic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 13, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
Amino Acid Sequences RSEHCVRHRRSHTNEKPFKCKFCHRGYARKDLVVRHEETLYNSDTRLQLSVNYRCHSLAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.82
3 0.83
4 0.79
5 0.75
6 0.7
7 0.69
8 0.66
9 0.64
10 0.68
11 0.64
12 0.68
13 0.68
14 0.71
15 0.63
16 0.59
17 0.53
18 0.45
19 0.44
20 0.39
21 0.35
22 0.27
23 0.26
24 0.23
25 0.24
26 0.24
27 0.21
28 0.17
29 0.15
30 0.17
31 0.16
32 0.16
33 0.15
34 0.13
35 0.16
36 0.23
37 0.31
38 0.34
39 0.36
40 0.36