Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2T0Z8

Protein Details
Accession M2T0Z8    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
218-241LDELLASRSQKKKNKAKGKGVQEAHydrophilic
NLS Segment(s)
PositionSequence
95-122KKKAKAHLAAKQEAERRGAASQPKPSRK
144-152KRRKIARPK
226-236SQKKKNKAKGK
Subcellular Location(s) nucl 14, cyto_nucl 10, mito 9, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021641  DUF3245  
Pfam View protein in Pfam  
PF11595  DUF3245  
Amino Acid Sequences MSKRNMDGDVLANKLSLVSAKGQKLLASMLGPQPDAQPSHDAPNEEEKDNDLDRNFSGHDRLGVGSIPPKDIADGTFTRRTMTSDDKLLQQLSGKKKAKAHLAAKQEAERRGAASQPKPSRKEVAKQEESEDEEEGRAAAFESKRRKIARPKAGLVSEEDGGSEREATSVPPDEEEEQKSAKEIVPERKFYDDVEPAVTAPKAKPLPSRSRAKPTSYLDELLASRSQKKKNKAKGKGVQEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.12
4 0.09
5 0.14
6 0.21
7 0.23
8 0.26
9 0.26
10 0.27
11 0.27
12 0.26
13 0.21
14 0.15
15 0.16
16 0.17
17 0.18
18 0.18
19 0.17
20 0.18
21 0.19
22 0.2
23 0.19
24 0.21
25 0.21
26 0.27
27 0.29
28 0.29
29 0.28
30 0.37
31 0.38
32 0.34
33 0.32
34 0.28
35 0.3
36 0.3
37 0.3
38 0.2
39 0.19
40 0.18
41 0.2
42 0.19
43 0.16
44 0.17
45 0.15
46 0.15
47 0.15
48 0.15
49 0.13
50 0.12
51 0.12
52 0.14
53 0.14
54 0.14
55 0.13
56 0.13
57 0.13
58 0.13
59 0.13
60 0.13
61 0.14
62 0.19
63 0.22
64 0.22
65 0.23
66 0.23
67 0.24
68 0.23
69 0.28
70 0.25
71 0.25
72 0.26
73 0.27
74 0.29
75 0.27
76 0.23
77 0.21
78 0.25
79 0.27
80 0.36
81 0.37
82 0.39
83 0.43
84 0.46
85 0.5
86 0.52
87 0.52
88 0.49
89 0.53
90 0.52
91 0.5
92 0.5
93 0.47
94 0.4
95 0.35
96 0.28
97 0.23
98 0.2
99 0.22
100 0.23
101 0.22
102 0.29
103 0.35
104 0.42
105 0.43
106 0.45
107 0.48
108 0.45
109 0.49
110 0.51
111 0.53
112 0.51
113 0.48
114 0.48
115 0.44
116 0.44
117 0.37
118 0.28
119 0.18
120 0.13
121 0.12
122 0.1
123 0.07
124 0.05
125 0.04
126 0.07
127 0.08
128 0.14
129 0.21
130 0.24
131 0.3
132 0.33
133 0.4
134 0.47
135 0.57
136 0.61
137 0.62
138 0.63
139 0.62
140 0.61
141 0.55
142 0.47
143 0.39
144 0.29
145 0.22
146 0.18
147 0.13
148 0.12
149 0.11
150 0.09
151 0.06
152 0.06
153 0.07
154 0.07
155 0.09
156 0.11
157 0.11
158 0.12
159 0.14
160 0.15
161 0.19
162 0.21
163 0.2
164 0.18
165 0.18
166 0.18
167 0.18
168 0.17
169 0.2
170 0.24
171 0.32
172 0.37
173 0.41
174 0.43
175 0.45
176 0.44
177 0.4
178 0.41
179 0.34
180 0.29
181 0.28
182 0.26
183 0.22
184 0.24
185 0.22
186 0.17
187 0.14
188 0.2
189 0.2
190 0.23
191 0.31
192 0.37
193 0.47
194 0.54
195 0.64
196 0.63
197 0.71
198 0.73
199 0.72
200 0.72
201 0.68
202 0.68
203 0.62
204 0.56
205 0.47
206 0.45
207 0.39
208 0.33
209 0.31
210 0.25
211 0.29
212 0.35
213 0.43
214 0.48
215 0.59
216 0.66
217 0.73
218 0.82
219 0.85
220 0.88
221 0.88