Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2U5D4

Protein Details
Accession M2U5D4    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
45-73APSNRVEKRSARKGKRSPARKPSPGEAFSHydrophilic
NLS Segment(s)
PositionSequence
50-67VEKRSARKGKRSPARKPS
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MPTISSRELKDLSIDPQRDLYKLRTSQPSSSGRRYTRASSASLTAPSNRVEKRSARKGKRSPARKPSPGEAFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.29
3 0.33
4 0.34
5 0.31
6 0.32
7 0.31
8 0.31
9 0.33
10 0.37
11 0.39
12 0.42
13 0.43
14 0.47
15 0.51
16 0.48
17 0.51
18 0.53
19 0.46
20 0.47
21 0.48
22 0.43
23 0.4
24 0.36
25 0.32
26 0.26
27 0.26
28 0.23
29 0.22
30 0.2
31 0.16
32 0.16
33 0.16
34 0.2
35 0.19
36 0.21
37 0.23
38 0.3
39 0.38
40 0.48
41 0.57
42 0.6
43 0.7
44 0.76
45 0.83
46 0.86
47 0.86
48 0.86
49 0.87
50 0.88
51 0.86
52 0.83
53 0.81