Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2A9L1

Protein Details
Accession B2A9L1    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
38-60EKNKTKPSCKKSKSELTKKKLGKBasic
NLS Segment(s)
PositionSequence
47-83KKSKSELTKKKLGKQHIPNDLGKKADNRDAKKDRNAP
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 8
Family & Domain DBs
KEGG pan:PODANSg09325  -  
Amino Acid Sequences MAIHSALMATRTAAADSMSNVQCGFMRCSYVQNTVAQEKNKTKPSCKKSKSELTKKKLGKQHIPNDLGKKADNRDAKKDRNAPFHAKDNVRQRTKHPKLIGADVYVVRLAHRGTGTDHIKAEEVDDSRLLDMPPLFDVDAPSSSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.11
4 0.17
5 0.16
6 0.16
7 0.16
8 0.16
9 0.18
10 0.2
11 0.22
12 0.15
13 0.19
14 0.19
15 0.24
16 0.26
17 0.29
18 0.28
19 0.28
20 0.31
21 0.32
22 0.36
23 0.34
24 0.37
25 0.39
26 0.43
27 0.49
28 0.49
29 0.53
30 0.58
31 0.65
32 0.7
33 0.69
34 0.71
35 0.7
36 0.77
37 0.79
38 0.8
39 0.81
40 0.77
41 0.81
42 0.77
43 0.76
44 0.72
45 0.68
46 0.67
47 0.66
48 0.68
49 0.67
50 0.66
51 0.62
52 0.6
53 0.54
54 0.46
55 0.37
56 0.32
57 0.25
58 0.28
59 0.31
60 0.3
61 0.38
62 0.44
63 0.47
64 0.52
65 0.58
66 0.56
67 0.58
68 0.6
69 0.57
70 0.54
71 0.56
72 0.56
73 0.49
74 0.51
75 0.52
76 0.57
77 0.54
78 0.52
79 0.52
80 0.57
81 0.62
82 0.63
83 0.56
84 0.53
85 0.51
86 0.56
87 0.51
88 0.4
89 0.36
90 0.28
91 0.27
92 0.21
93 0.18
94 0.12
95 0.11
96 0.1
97 0.1
98 0.1
99 0.11
100 0.13
101 0.21
102 0.24
103 0.25
104 0.26
105 0.24
106 0.24
107 0.23
108 0.22
109 0.19
110 0.17
111 0.16
112 0.16
113 0.16
114 0.16
115 0.17
116 0.16
117 0.14
118 0.13
119 0.13
120 0.13
121 0.14
122 0.14
123 0.13
124 0.15
125 0.15