Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2TE86

Protein Details
Accession M2TE86    Localization Confidence High Confidence Score 19.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-33GAAPAQHKQPSRKGKKAWRKNVDVTQIQSHydrophilic
259-299SDNENKEVKKKRPERKTISQRNKIKKRKEAERKAKHEAKMKBasic
NLS Segment(s)
PositionSequence
14-23PSRKGKKAWR
162-176KKKPKVEPKTLKHAP
181-181R
183-184GK
266-302VKKKRPERKTISQRNKIKKRKEAERKAKHEAKMKAKE
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011687  Nop53/GLTSCR2  
Gene Ontology GO:0005730  C:nucleolus  
GO:0005654  C:nucleoplasm  
GO:0000027  P:ribosomal large subunit assembly  
Pfam View protein in Pfam  
PF07767  Nop53  
Amino Acid Sequences MADSGAAPAQHKQPSRKGKKAWRKNVDVTQIQSGLEEVREQIIQGGVIAEKPADELFAVDTLGSAEIKKSIAKRHKPLKVDEILAQRSAVPAVSTRKRLSDIADDGKRKKTKVSSKEYDRLRAIAYGGEQVKKDVVQTSDAVYDPWAVQEVKEDPRFEYLEKKKPKVEPKTLKHAPVSQARTGKPIPAVRKPTGGKSYNPLLEDWQNELMRESDKVVEAEKKRLEEAREEAERMERAAAETESDSGEESVWESEWEGFSDNENKEVKKKRPERKTISQRNKIKKRKEAERKAKHEAKMKAKEQQLQEVKRLAKSVEEKEKARAAVRQALEKQNAEAVEDDGEEIELRKKQFGKAPLPEAPLEVVLPDELRDSLRLLKPEGNLLKDRFRTMLLQGKVEARRQIPYAKQKKYTVSEKWSYKDWQLPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.69
3 0.74
4 0.78
5 0.82
6 0.87
7 0.91
8 0.92
9 0.91
10 0.9
11 0.89
12 0.88
13 0.86
14 0.8
15 0.73
16 0.68
17 0.59
18 0.5
19 0.41
20 0.32
21 0.24
22 0.19
23 0.16
24 0.1
25 0.11
26 0.11
27 0.11
28 0.12
29 0.11
30 0.1
31 0.1
32 0.1
33 0.08
34 0.08
35 0.09
36 0.07
37 0.06
38 0.08
39 0.07
40 0.07
41 0.06
42 0.07
43 0.08
44 0.08
45 0.08
46 0.07
47 0.07
48 0.07
49 0.08
50 0.07
51 0.06
52 0.07
53 0.08
54 0.09
55 0.13
56 0.16
57 0.26
58 0.36
59 0.45
60 0.55
61 0.64
62 0.71
63 0.72
64 0.75
65 0.74
66 0.69
67 0.63
68 0.59
69 0.57
70 0.51
71 0.46
72 0.4
73 0.31
74 0.26
75 0.23
76 0.17
77 0.09
78 0.11
79 0.19
80 0.24
81 0.3
82 0.31
83 0.33
84 0.36
85 0.36
86 0.36
87 0.36
88 0.37
89 0.4
90 0.46
91 0.49
92 0.49
93 0.57
94 0.57
95 0.5
96 0.5
97 0.51
98 0.54
99 0.58
100 0.65
101 0.66
102 0.72
103 0.79
104 0.77
105 0.74
106 0.65
107 0.57
108 0.47
109 0.39
110 0.3
111 0.24
112 0.2
113 0.18
114 0.19
115 0.19
116 0.18
117 0.18
118 0.18
119 0.17
120 0.17
121 0.15
122 0.14
123 0.14
124 0.15
125 0.16
126 0.17
127 0.16
128 0.15
129 0.12
130 0.12
131 0.1
132 0.09
133 0.1
134 0.08
135 0.08
136 0.11
137 0.14
138 0.19
139 0.22
140 0.23
141 0.22
142 0.25
143 0.27
144 0.24
145 0.31
146 0.33
147 0.39
148 0.45
149 0.48
150 0.5
151 0.56
152 0.66
153 0.65
154 0.69
155 0.7
156 0.69
157 0.76
158 0.75
159 0.71
160 0.63
161 0.58
162 0.53
163 0.5
164 0.49
165 0.43
166 0.44
167 0.41
168 0.43
169 0.38
170 0.35
171 0.32
172 0.32
173 0.33
174 0.35
175 0.41
176 0.37
177 0.44
178 0.43
179 0.44
180 0.46
181 0.44
182 0.37
183 0.35
184 0.39
185 0.35
186 0.34
187 0.29
188 0.23
189 0.23
190 0.23
191 0.21
192 0.21
193 0.18
194 0.17
195 0.18
196 0.16
197 0.14
198 0.13
199 0.12
200 0.08
201 0.09
202 0.09
203 0.1
204 0.16
205 0.17
206 0.23
207 0.23
208 0.23
209 0.24
210 0.26
211 0.26
212 0.23
213 0.25
214 0.25
215 0.24
216 0.24
217 0.23
218 0.22
219 0.21
220 0.18
221 0.15
222 0.09
223 0.08
224 0.1
225 0.09
226 0.08
227 0.08
228 0.08
229 0.08
230 0.08
231 0.07
232 0.06
233 0.06
234 0.05
235 0.05
236 0.05
237 0.05
238 0.05
239 0.05
240 0.06
241 0.06
242 0.07
243 0.07
244 0.07
245 0.09
246 0.15
247 0.15
248 0.19
249 0.21
250 0.21
251 0.27
252 0.35
253 0.41
254 0.45
255 0.55
256 0.6
257 0.69
258 0.79
259 0.81
260 0.84
261 0.88
262 0.89
263 0.9
264 0.9
265 0.89
266 0.9
267 0.91
268 0.9
269 0.88
270 0.85
271 0.83
272 0.84
273 0.86
274 0.86
275 0.87
276 0.88
277 0.86
278 0.87
279 0.86
280 0.8
281 0.78
282 0.75
283 0.74
284 0.73
285 0.69
286 0.66
287 0.64
288 0.65
289 0.59
290 0.6
291 0.59
292 0.52
293 0.53
294 0.52
295 0.49
296 0.44
297 0.43
298 0.33
299 0.31
300 0.34
301 0.38
302 0.42
303 0.45
304 0.45
305 0.48
306 0.52
307 0.47
308 0.43
309 0.38
310 0.33
311 0.36
312 0.36
313 0.39
314 0.4
315 0.45
316 0.47
317 0.44
318 0.4
319 0.35
320 0.34
321 0.27
322 0.22
323 0.16
324 0.13
325 0.12
326 0.11
327 0.08
328 0.08
329 0.07
330 0.08
331 0.1
332 0.13
333 0.14
334 0.19
335 0.21
336 0.26
337 0.32
338 0.4
339 0.46
340 0.49
341 0.55
342 0.56
343 0.57
344 0.53
345 0.47
346 0.4
347 0.31
348 0.24
349 0.17
350 0.12
351 0.09
352 0.09
353 0.08
354 0.08
355 0.08
356 0.09
357 0.1
358 0.11
359 0.19
360 0.22
361 0.25
362 0.27
363 0.31
364 0.31
365 0.4
366 0.43
367 0.4
368 0.42
369 0.44
370 0.49
371 0.47
372 0.48
373 0.4
374 0.38
375 0.36
376 0.36
377 0.41
378 0.35
379 0.35
380 0.35
381 0.41
382 0.43
383 0.45
384 0.45
385 0.38
386 0.39
387 0.4
388 0.45
389 0.47
390 0.54
391 0.6
392 0.62
393 0.68
394 0.7
395 0.75
396 0.76
397 0.76
398 0.74
399 0.73
400 0.74
401 0.73
402 0.71
403 0.68
404 0.64
405 0.61