Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2U9N9

Protein Details
Accession M2U9N9    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
67-89DGPVSAKKPKKVKERQREEMKAIBasic
NLS Segment(s)
PositionSequence
72-87AKKPKKVKERQREEMK
Subcellular Location(s) mito 19.5, cyto_mito 12, cyto 3.5, nucl 3
Family & Domain DBs
Amino Acid Sequences MAKSCTLCSTPRPVLVRCQIDSTEKWHFVCPGACWRAVSGGVEDAKGLKEEFPYYRYGGMWKDRSADGPVSAKKPKKVKERQREEMKAIGRNGGGAEGEKVDAEVSEDGTALA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.53
3 0.54
4 0.47
5 0.46
6 0.41
7 0.41
8 0.41
9 0.38
10 0.37
11 0.34
12 0.34
13 0.32
14 0.31
15 0.29
16 0.29
17 0.26
18 0.28
19 0.27
20 0.26
21 0.25
22 0.24
23 0.23
24 0.22
25 0.2
26 0.11
27 0.12
28 0.12
29 0.12
30 0.11
31 0.1
32 0.1
33 0.1
34 0.09
35 0.06
36 0.07
37 0.09
38 0.1
39 0.11
40 0.13
41 0.13
42 0.14
43 0.13
44 0.14
45 0.15
46 0.2
47 0.21
48 0.2
49 0.21
50 0.21
51 0.22
52 0.23
53 0.21
54 0.17
55 0.19
56 0.21
57 0.23
58 0.3
59 0.32
60 0.36
61 0.43
62 0.49
63 0.55
64 0.64
65 0.7
66 0.75
67 0.81
68 0.85
69 0.88
70 0.86
71 0.79
72 0.75
73 0.69
74 0.63
75 0.54
76 0.46
77 0.35
78 0.3
79 0.26
80 0.2
81 0.16
82 0.11
83 0.11
84 0.09
85 0.09
86 0.09
87 0.09
88 0.08
89 0.07
90 0.09
91 0.08
92 0.09
93 0.09