Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2U7Y9

Protein Details
Accession M2U7Y9   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
176-197VTLLCLRRRKKRRAEAAAQEMKHydrophilic
NLS Segment(s)
PositionSequence
182-189RRRKKRRA
Subcellular Location(s) plas 8, nucl 7.5, cyto_nucl 6, mito 4, cyto 3.5, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAPQQDGWEKEERGPPPWVTQDDFYVTIVTTISLHSEAPAEQSEPTSMAFQTQSLDDADTQTRRRPSTRPDGYPSTLPWPPYPYGGHAATTNPWEMSISKTAALTETPYPELDSTLLLSITNGFPTTTGASSSPTIGSYGGRPSGWEWSDKGTDKAPVYAAAAIVPVIILVLIGGVTLLCLRRRKKRRAEAAAQEMKLEPGSPTIRPHMAPLPAPIPAVAVSQNYTAPPSHLPPTSGWNQPQPIIIGPIVSSSNGAYLTGMDTSDMVSITSNPRMSVDPFSDSYSLSGPPPPYRPNSVPPPSFTSNSRHSSVRLPTSPVCLARSPFDDPEDGMSFMEDGEVQGERYARAYTTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.42
3 0.41
4 0.46
5 0.44
6 0.4
7 0.4
8 0.39
9 0.38
10 0.37
11 0.31
12 0.25
13 0.21
14 0.17
15 0.16
16 0.12
17 0.09
18 0.08
19 0.09
20 0.09
21 0.09
22 0.09
23 0.1
24 0.1
25 0.13
26 0.14
27 0.13
28 0.13
29 0.14
30 0.14
31 0.14
32 0.15
33 0.13
34 0.12
35 0.13
36 0.13
37 0.12
38 0.13
39 0.12
40 0.13
41 0.12
42 0.13
43 0.11
44 0.14
45 0.18
46 0.21
47 0.23
48 0.28
49 0.33
50 0.35
51 0.39
52 0.42
53 0.46
54 0.53
55 0.59
56 0.6
57 0.61
58 0.64
59 0.64
60 0.61
61 0.55
62 0.49
63 0.42
64 0.37
65 0.32
66 0.3
67 0.28
68 0.28
69 0.27
70 0.25
71 0.28
72 0.27
73 0.26
74 0.22
75 0.22
76 0.21
77 0.21
78 0.19
79 0.13
80 0.12
81 0.12
82 0.12
83 0.14
84 0.16
85 0.15
86 0.15
87 0.15
88 0.15
89 0.15
90 0.15
91 0.14
92 0.12
93 0.13
94 0.14
95 0.14
96 0.15
97 0.14
98 0.15
99 0.12
100 0.1
101 0.09
102 0.08
103 0.08
104 0.07
105 0.07
106 0.07
107 0.07
108 0.07
109 0.07
110 0.06
111 0.06
112 0.08
113 0.09
114 0.08
115 0.09
116 0.09
117 0.11
118 0.11
119 0.12
120 0.11
121 0.09
122 0.1
123 0.09
124 0.09
125 0.09
126 0.1
127 0.11
128 0.1
129 0.1
130 0.11
131 0.16
132 0.16
133 0.16
134 0.15
135 0.17
136 0.21
137 0.22
138 0.22
139 0.18
140 0.21
141 0.2
142 0.2
143 0.17
144 0.14
145 0.14
146 0.13
147 0.11
148 0.08
149 0.07
150 0.06
151 0.05
152 0.04
153 0.03
154 0.02
155 0.02
156 0.02
157 0.01
158 0.01
159 0.01
160 0.01
161 0.01
162 0.01
163 0.02
164 0.02
165 0.04
166 0.07
167 0.13
168 0.17
169 0.27
170 0.37
171 0.47
172 0.57
173 0.66
174 0.74
175 0.77
176 0.82
177 0.79
178 0.8
179 0.77
180 0.66
181 0.57
182 0.46
183 0.38
184 0.29
185 0.21
186 0.11
187 0.09
188 0.11
189 0.11
190 0.13
191 0.16
192 0.17
193 0.17
194 0.2
195 0.2
196 0.2
197 0.2
198 0.2
199 0.18
200 0.17
201 0.17
202 0.14
203 0.11
204 0.1
205 0.1
206 0.08
207 0.08
208 0.08
209 0.09
210 0.1
211 0.09
212 0.1
213 0.09
214 0.1
215 0.11
216 0.13
217 0.16
218 0.16
219 0.18
220 0.18
221 0.23
222 0.26
223 0.29
224 0.28
225 0.3
226 0.3
227 0.3
228 0.3
229 0.26
230 0.22
231 0.19
232 0.17
233 0.12
234 0.11
235 0.11
236 0.1
237 0.09
238 0.09
239 0.07
240 0.08
241 0.07
242 0.07
243 0.06
244 0.06
245 0.07
246 0.07
247 0.07
248 0.06
249 0.06
250 0.06
251 0.07
252 0.06
253 0.05
254 0.05
255 0.07
256 0.1
257 0.15
258 0.15
259 0.14
260 0.16
261 0.18
262 0.2
263 0.23
264 0.22
265 0.22
266 0.23
267 0.26
268 0.25
269 0.23
270 0.22
271 0.19
272 0.17
273 0.14
274 0.17
275 0.18
276 0.21
277 0.26
278 0.3
279 0.33
280 0.39
281 0.43
282 0.46
283 0.53
284 0.58
285 0.56
286 0.55
287 0.58
288 0.55
289 0.54
290 0.49
291 0.45
292 0.45
293 0.46
294 0.45
295 0.39
296 0.37
297 0.42
298 0.46
299 0.48
300 0.44
301 0.44
302 0.44
303 0.48
304 0.5
305 0.45
306 0.41
307 0.36
308 0.36
309 0.34
310 0.36
311 0.36
312 0.33
313 0.33
314 0.31
315 0.28
316 0.32
317 0.3
318 0.27
319 0.22
320 0.19
321 0.17
322 0.15
323 0.15
324 0.09
325 0.06
326 0.07
327 0.08
328 0.08
329 0.1
330 0.11
331 0.11
332 0.13
333 0.14