Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2UUG7

Protein Details
Accession M2UUG7   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
27-52LTAQRTRTREERKEKKSRVRESRPVLHydrophilic
NLS Segment(s)
PositionSequence
34-46TREERKEKKSRVR
Subcellular Location(s) nucl 13, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MALHAIVVLTASLRDAKRRDWHRDAQLTAQRTRTREERKEKKSRVRESRPVLVFPSEDIGGKKNTNENESRGYEWPTRKTPSSTAPQRHTLNVCEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.2
3 0.26
4 0.36
5 0.44
6 0.52
7 0.55
8 0.63
9 0.66
10 0.7
11 0.66
12 0.65
13 0.63
14 0.58
15 0.54
16 0.52
17 0.46
18 0.41
19 0.42
20 0.43
21 0.46
22 0.51
23 0.59
24 0.63
25 0.69
26 0.78
27 0.82
28 0.84
29 0.84
30 0.85
31 0.85
32 0.83
33 0.83
34 0.78
35 0.78
36 0.69
37 0.6
38 0.51
39 0.41
40 0.32
41 0.24
42 0.2
43 0.12
44 0.11
45 0.11
46 0.11
47 0.13
48 0.13
49 0.14
50 0.17
51 0.19
52 0.23
53 0.25
54 0.26
55 0.3
56 0.32
57 0.34
58 0.31
59 0.34
60 0.36
61 0.39
62 0.42
63 0.41
64 0.44
65 0.44
66 0.46
67 0.46
68 0.47
69 0.52
70 0.56
71 0.59
72 0.6
73 0.65
74 0.64
75 0.65
76 0.62