Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2TI83

Protein Details
Accession M2TI83    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-27SSFPSKDIERPSKRPKEKPNSPNLLRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MSSFPSKDIERPSKRPKEKPNSPNLLRFVACSPTHSLPYQIHYHIVQTLIKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.82
3 0.84
4 0.84
5 0.87
6 0.86
7 0.86
8 0.85
9 0.79
10 0.76
11 0.68
12 0.6
13 0.49
14 0.41
15 0.33
16 0.28
17 0.25
18 0.21
19 0.23
20 0.22
21 0.24
22 0.23
23 0.25
24 0.22
25 0.26
26 0.28
27 0.24
28 0.25
29 0.23
30 0.24
31 0.23
32 0.24