Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2SZN1

Protein Details
Accession M2SZN1   
Localization Confidence Low
Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
44-70LPHSAWKQYKSKKCKHIRYANRQKGDLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12.5, mito_nucl 10.833, nucl 8, cyto_nucl 7.833, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000064  NLP_P60_dom  
IPR038765  Papain-like_cys_pep_sf  
Pfam View protein in Pfam  
PF00877  NLPC_P60  
PROSITE View protein in PROSITE  
PS51935  NLPC_P60  
Amino Acid Sequences ALKQRGVPYKWGGGDCNGPTKGGFDCSGLTKYAVCKATSKKKVLPHSAWKQYKSKKCKHIRYANRQKGDLVFWSTKKSGKCTKDSSIKHVAVVQNDKYIIVAPKAGQKVKRQKMWSGHGGLYRCNYVARCC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.36
3 0.38
4 0.31
5 0.28
6 0.26
7 0.26
8 0.24
9 0.21
10 0.19
11 0.13
12 0.15
13 0.17
14 0.18
15 0.18
16 0.17
17 0.15
18 0.16
19 0.21
20 0.22
21 0.2
22 0.24
23 0.31
24 0.41
25 0.48
26 0.51
27 0.51
28 0.56
29 0.64
30 0.67
31 0.66
32 0.66
33 0.67
34 0.72
35 0.72
36 0.68
37 0.68
38 0.69
39 0.71
40 0.7
41 0.7
42 0.7
43 0.75
44 0.81
45 0.83
46 0.84
47 0.85
48 0.87
49 0.9
50 0.88
51 0.81
52 0.71
53 0.62
54 0.52
55 0.43
56 0.34
57 0.27
58 0.21
59 0.19
60 0.22
61 0.22
62 0.25
63 0.24
64 0.28
65 0.32
66 0.35
67 0.4
68 0.43
69 0.49
70 0.55
71 0.56
72 0.57
73 0.57
74 0.53
75 0.47
76 0.46
77 0.41
78 0.36
79 0.39
80 0.33
81 0.26
82 0.26
83 0.25
84 0.21
85 0.21
86 0.17
87 0.13
88 0.13
89 0.12
90 0.19
91 0.24
92 0.29
93 0.31
94 0.4
95 0.5
96 0.57
97 0.65
98 0.62
99 0.66
100 0.7
101 0.73
102 0.71
103 0.65
104 0.6
105 0.57
106 0.54
107 0.49
108 0.43
109 0.37
110 0.3
111 0.29