Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2TBK8

Protein Details
Accession M2TBK8    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
65-94HPPTTHRNTEPRHHKRRKRQRHGQASVPGLBasic
NLS Segment(s)
PositionSequence
75-86PRHHKRRKRQRH
Subcellular Location(s) mito 14, cyto 5.5, cyto_nucl 5, nucl 3.5, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036291  NAD(P)-bd_dom_sf  
Amino Acid Sequences MTPTPTLTPQKANLKGEIVVITGASKGLGKATVISYAQAGASNMILAAHSSLDPVVSAVVEAASHPPTTHRNTEPRHHKRRKRQRHGQASVPGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.43
3 0.4
4 0.32
5 0.23
6 0.16
7 0.13
8 0.11
9 0.08
10 0.07
11 0.06
12 0.05
13 0.05
14 0.05
15 0.06
16 0.06
17 0.07
18 0.08
19 0.1
20 0.1
21 0.1
22 0.09
23 0.09
24 0.09
25 0.08
26 0.08
27 0.05
28 0.05
29 0.05
30 0.04
31 0.04
32 0.04
33 0.03
34 0.03
35 0.03
36 0.03
37 0.03
38 0.03
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.05
50 0.06
51 0.07
52 0.07
53 0.1
54 0.15
55 0.2
56 0.25
57 0.29
58 0.37
59 0.42
60 0.53
61 0.61
62 0.67
63 0.74
64 0.79
65 0.84
66 0.87
67 0.93
68 0.94
69 0.94
70 0.95
71 0.95
72 0.95
73 0.92
74 0.89