Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2SK01

Protein Details
Accession M2SK01    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
5-35NMNQGKGPSKPHHKKNKDDKKKINYYACGKEHydrophilic
NLS Segment(s)
PositionSequence
11-26GPSKPHHKKNKDDKKK
Subcellular Location(s) nucl 22, cyto_nucl 12.833, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MHLDNMNQGKGPSKPHHKKNKDDKKKINYYACGKEGHIARNCLSKNKVKRHLNVLHHKSELDDNESWNVITRLEITYHPDDTEVISGLDNLTLTTSEDTSKAEPASDEEYETPNEEERHLASKYEKIARFQEENRPSTPYHAKGMPKCKWL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.61
3 0.72
4 0.77
5 0.85
6 0.88
7 0.91
8 0.91
9 0.92
10 0.92
11 0.91
12 0.93
13 0.91
14 0.88
15 0.84
16 0.8
17 0.77
18 0.69
19 0.6
20 0.5
21 0.46
22 0.42
23 0.41
24 0.38
25 0.34
26 0.32
27 0.38
28 0.38
29 0.38
30 0.39
31 0.4
32 0.45
33 0.53
34 0.62
35 0.62
36 0.65
37 0.69
38 0.74
39 0.74
40 0.76
41 0.71
42 0.65
43 0.58
44 0.54
45 0.45
46 0.4
47 0.32
48 0.26
49 0.2
50 0.17
51 0.18
52 0.18
53 0.16
54 0.14
55 0.13
56 0.08
57 0.07
58 0.07
59 0.07
60 0.08
61 0.09
62 0.12
63 0.14
64 0.14
65 0.14
66 0.13
67 0.13
68 0.12
69 0.12
70 0.08
71 0.06
72 0.06
73 0.06
74 0.05
75 0.05
76 0.05
77 0.04
78 0.04
79 0.04
80 0.05
81 0.05
82 0.06
83 0.06
84 0.07
85 0.09
86 0.1
87 0.11
88 0.1
89 0.1
90 0.1
91 0.12
92 0.16
93 0.14
94 0.15
95 0.14
96 0.16
97 0.17
98 0.18
99 0.16
100 0.15
101 0.16
102 0.15
103 0.15
104 0.15
105 0.19
106 0.18
107 0.19
108 0.18
109 0.22
110 0.28
111 0.35
112 0.36
113 0.36
114 0.41
115 0.45
116 0.48
117 0.48
118 0.53
119 0.52
120 0.53
121 0.51
122 0.48
123 0.43
124 0.44
125 0.49
126 0.41
127 0.39
128 0.42
129 0.48
130 0.54
131 0.63