Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2U434

Protein Details
Accession M2U434   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
7-39KDKYSESQLKKKRWLDRRNRKKARQQSKLTAAEHydrophilic
NLS Segment(s)
PositionSequence
16-30KKKRWLDRRNRKKAR
Subcellular Location(s) nucl 22.5, cyto_nucl 12, mito 3
Family & Domain DBs
Amino Acid Sequences MEKINWKDKYSESQLKKKRWLDRRNRKKARQQSKLTAAELEEQLQLVLTGEQGALINRLKEENMRLRTKLTQYQTKLENIVLAGKEMLDSDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.72
3 0.78
4 0.78
5 0.78
6 0.78
7 0.81
8 0.82
9 0.85
10 0.88
11 0.9
12 0.93
13 0.92
14 0.92
15 0.92
16 0.92
17 0.9
18 0.87
19 0.84
20 0.83
21 0.78
22 0.68
23 0.58
24 0.48
25 0.4
26 0.32
27 0.24
28 0.15
29 0.11
30 0.1
31 0.08
32 0.07
33 0.05
34 0.04
35 0.03
36 0.03
37 0.03
38 0.03
39 0.04
40 0.04
41 0.06
42 0.07
43 0.07
44 0.07
45 0.08
46 0.08
47 0.1
48 0.16
49 0.23
50 0.29
51 0.32
52 0.33
53 0.36
54 0.41
55 0.44
56 0.46
57 0.45
58 0.47
59 0.47
60 0.52
61 0.52
62 0.5
63 0.46
64 0.39
65 0.33
66 0.25
67 0.26
68 0.2
69 0.18
70 0.15
71 0.13
72 0.13