Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2UIP8

Protein Details
Accession M2UIP8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
3-30AAKKHVPIVKKHTKRFNRHQSDRFKCVDHydrophilic
NLS Segment(s)
PositionSequence
34-57RKPKGIDNAVRRRFKGRAAMPKIG
Subcellular Location(s) mito 17, cyto 8, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVAAKKHVPIVKKHTKRFNRHQSDRFKCVDPSWRKPKGIDNAVRRRFKGRAAMPKIGYGSNKKTRHMMPSGHKAFLTTSVADVDLLLMHNSTFAAEIAHAVSARKRIDIIARAKQLGVKVTNGKARVKTES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.79
3 0.84
4 0.87
5 0.89
6 0.88
7 0.89
8 0.89
9 0.89
10 0.87
11 0.83
12 0.76
13 0.68
14 0.59
15 0.53
16 0.55
17 0.52
18 0.54
19 0.58
20 0.61
21 0.59
22 0.59
23 0.63
24 0.63
25 0.64
26 0.62
27 0.62
28 0.66
29 0.73
30 0.75
31 0.68
32 0.63
33 0.55
34 0.5
35 0.49
36 0.46
37 0.48
38 0.51
39 0.55
40 0.51
41 0.51
42 0.49
43 0.41
44 0.36
45 0.3
46 0.31
47 0.34
48 0.36
49 0.35
50 0.38
51 0.38
52 0.41
53 0.4
54 0.39
55 0.36
56 0.44
57 0.45
58 0.42
59 0.4
60 0.35
61 0.31
62 0.28
63 0.23
64 0.13
65 0.11
66 0.11
67 0.11
68 0.1
69 0.1
70 0.07
71 0.05
72 0.05
73 0.05
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.05
80 0.04
81 0.04
82 0.04
83 0.05
84 0.06
85 0.06
86 0.07
87 0.07
88 0.09
89 0.14
90 0.15
91 0.15
92 0.15
93 0.16
94 0.23
95 0.3
96 0.36
97 0.39
98 0.42
99 0.43
100 0.43
101 0.43
102 0.39
103 0.37
104 0.32
105 0.28
106 0.31
107 0.35
108 0.41
109 0.42
110 0.45
111 0.45