Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2UNC1

Protein Details
Accession M2UNC1    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
74-107GKKGRSFKGRRDKMKEHMKTVHDNRARKRRRIEEBasic
NLS Segment(s)
PositionSequence
73-105DGKKGRSFKGRRDKMKEHMKTVHDNRARKRRRI
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences TSISKTTEADPIIGQVTLGGRFTCLSKDCRDDETLTFNRHADFKRHYTNMHARKLTEYFCPEKGCHRSRYPADGKKGRSFKGRRDKMKEHMKTVHDNRARKRRRIEES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.1
3 0.11
4 0.1
5 0.11
6 0.09
7 0.08
8 0.09
9 0.1
10 0.13
11 0.14
12 0.17
13 0.2
14 0.25
15 0.27
16 0.3
17 0.32
18 0.31
19 0.3
20 0.34
21 0.34
22 0.32
23 0.31
24 0.27
25 0.25
26 0.27
27 0.27
28 0.24
29 0.25
30 0.28
31 0.34
32 0.35
33 0.35
34 0.39
35 0.47
36 0.5
37 0.51
38 0.47
39 0.4
40 0.41
41 0.43
42 0.37
43 0.3
44 0.26
45 0.22
46 0.24
47 0.25
48 0.23
49 0.29
50 0.36
51 0.37
52 0.39
53 0.39
54 0.45
55 0.45
56 0.54
57 0.56
58 0.55
59 0.6
60 0.61
61 0.64
62 0.65
63 0.67
64 0.61
65 0.62
66 0.59
67 0.6
68 0.65
69 0.69
70 0.7
71 0.74
72 0.78
73 0.78
74 0.84
75 0.8
76 0.76
77 0.74
78 0.69
79 0.7
80 0.69
81 0.7
82 0.66
83 0.68
84 0.7
85 0.74
86 0.78
87 0.76
88 0.8