Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2U3B7

Protein Details
Accession M2U3B7    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-37KSCIRIHWYRINRGNRKRQRRPCNAIEETHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, mito_nucl 12, nucl 8.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MRRRLKQGKSCIRIHWYRINRGNRKRQRRPCNAIEETVPSACKRAARCCGPLPCA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.63
3 0.58
4 0.6
5 0.65
6 0.69
7 0.71
8 0.75
9 0.8
10 0.8
11 0.85
12 0.86
13 0.88
14 0.88
15 0.89
16 0.87
17 0.83
18 0.83
19 0.74
20 0.65
21 0.56
22 0.49
23 0.41
24 0.35
25 0.29
26 0.19
27 0.19
28 0.18
29 0.21
30 0.21
31 0.27
32 0.34
33 0.39
34 0.45
35 0.52