Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2UTZ5

Protein Details
Accession M2UTZ5    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
43-72ARKPRVALACKRCKRRKQRCNGARPVCRSCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MSQSYAESLLSPSGSADDHIPASSTATEIPSNSTGVGTQPAAARKPRVALACKRCKRRKQRCNGARPVCRSCERAGVACAYERTLRPQYPGGKSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.1
5 0.1
6 0.1
7 0.11
8 0.1
9 0.11
10 0.11
11 0.1
12 0.09
13 0.1
14 0.1
15 0.1
16 0.13
17 0.12
18 0.12
19 0.12
20 0.11
21 0.09
22 0.09
23 0.11
24 0.08
25 0.08
26 0.1
27 0.12
28 0.14
29 0.15
30 0.16
31 0.15
32 0.17
33 0.19
34 0.21
35 0.24
36 0.3
37 0.39
38 0.48
39 0.54
40 0.63
41 0.69
42 0.75
43 0.81
44 0.84
45 0.85
46 0.85
47 0.9
48 0.9
49 0.91
50 0.92
51 0.91
52 0.87
53 0.84
54 0.77
55 0.72
56 0.66
57 0.58
58 0.5
59 0.47
60 0.42
61 0.37
62 0.34
63 0.31
64 0.28
65 0.28
66 0.26
67 0.21
68 0.22
69 0.2
70 0.26
71 0.3
72 0.31
73 0.32
74 0.39
75 0.45