FuNGI

M2V9B3

Protein Details

Accession

M2V9B3

Localization Confidence

Medium

Confidence Score

10.6

NoLS Segment(s)

Position	Sequence	Protein Nature
4-37	LLTLCDSKIRRKKCDEEKPACRRCRDSQVKCDGY	Hydrophilic

NLS Segment(s)

Position	Sequence
55-59	AKAKK

Subcellular Location(s)

nucl 9.5, cyto_nucl 9, cyto 7.5, mito 6, plas 1, pero 1, E.R. 1, golg 1

Family & Domain DBs

InterPro	View protein in InterPro IPR021858 Fun_TF IPR036864 Zn2-C6_fun-type_DNA-bd_sf IPR001138 Zn2Cys6_DnaBD
Gene Ontology	GO:0005634 C:nucleus GO:0000981 F:DNA-binding transcription factor activity, RNA polymerase II-specific GO:0008270 F:zinc ion binding
Pfam	View protein in Pfam PF11951 Fungal_trans_2
CDD	cd00067 GAL4

Amino Acid Sequences

MKFLLTLCDSKIRRKKCDEEKPACRRCRDSQVKCDGYAPIPAQKKRSPLQKAVSAKAKKRTIQATPEMVQTVVKHSQPRFSIPGNKLNLEIDGSVYDRMFFHHFRSITMIDFVRLVNPKDFWSQRVLPMCHDEPAVRNAVIALGAAHYVYLQKLSKPYPREADTSMTYFECVATQYYNNAIGQLVTLNDANNSTLWDSQLRILTCCLLFICLENIFGRSDEGLRHMQAGARLLETFDLSTAPPNFQQLIQEIATVVQPFASLAEAKDAMWDLDVRMTYIECPDHESGVVPDKDHYIPDNMNELIEPFERWKTKFNLLVASQIDNTDVPIEIQRETLTLMLRRAVWEVIMPINSDNEAEELARLQRELVDMAELLYSIESSWLDRPIFTLDSDTIPALYFVGLSCEDPALAQRILALLRGSRRREGPWDSWKVADKLEAELLNPSPCPFKSGSDSSLSCRSGSTPNSAGSSPSSGTPDFTSSFSVCKTEFL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.67
2	0.75
3	0.77
4	0.86
5	0.86
6	0.87
7	0.9
8	0.91
9	0.92
10	0.9
11	0.85
12	0.81
13	0.78
14	0.79
15	0.79
16	0.78
17	0.78
18	0.81
19	0.78
20	0.72
21	0.66
22	0.58
23	0.49
24	0.46
25	0.38
26	0.35
27	0.4
28	0.43
29	0.47
30	0.48
31	0.54
32	0.55
33	0.62
34	0.62
35	0.63
36	0.67
37	0.69
38	0.72
39	0.72
40	0.74
41	0.73
42	0.71
43	0.72
44	0.72
45	0.67
46	0.68
47	0.68
48	0.66
49	0.66
50	0.67
51	0.64
52	0.59
53	0.57
54	0.5
55	0.42
56	0.36
57	0.28
58	0.26
59	0.24
60	0.25
61	0.29
62	0.3
63	0.36
64	0.37
65	0.42
66	0.41
67	0.42
68	0.49
69	0.47
70	0.54
71	0.51
72	0.5
73	0.45
74	0.41
75	0.36
76	0.28
77	0.23
78	0.15
79	0.12
80	0.13
81	0.12
82	0.12
83	0.11
84	0.1
85	0.12
86	0.16
87	0.16
88	0.18
89	0.24
90	0.25
91	0.25
92	0.3
93	0.29
94	0.26
95	0.28
96	0.25
97	0.18
98	0.19
99	0.18
100	0.17
101	0.19
102	0.2
103	0.19
104	0.2
105	0.22
106	0.28
107	0.3
108	0.27
109	0.31
110	0.31
111	0.35
112	0.42
113	0.41
114	0.36
115	0.41
116	0.41
117	0.34
118	0.33
119	0.28
120	0.22
121	0.24
122	0.24
123	0.17
124	0.16
125	0.14
126	0.14
127	0.13
128	0.1
129	0.07
130	0.04
131	0.04
132	0.04
133	0.04
134	0.04
135	0.05
136	0.05
137	0.08
138	0.08
139	0.1
140	0.14
141	0.19
142	0.25
143	0.29
144	0.34
145	0.37
146	0.4
147	0.41
148	0.4
149	0.4
150	0.36
151	0.33
152	0.3
153	0.24
154	0.21
155	0.17
156	0.15
157	0.11
158	0.09
159	0.08
160	0.08
161	0.08
162	0.09
163	0.1
164	0.12
165	0.11
166	0.11
167	0.1
168	0.08
169	0.08
170	0.08
171	0.06
172	0.06
173	0.06
174	0.06
175	0.06
176	0.07
177	0.07
178	0.06
179	0.07
180	0.07
181	0.07
182	0.08
183	0.09
184	0.09
185	0.11
186	0.15
187	0.15
188	0.14
189	0.14
190	0.15
191	0.14
192	0.14
193	0.11
194	0.08
195	0.08
196	0.08
197	0.09
198	0.07
199	0.08
200	0.08
201	0.09
202	0.09
203	0.09
204	0.09
205	0.07
206	0.08
207	0.07
208	0.11
209	0.11
210	0.11
211	0.12
212	0.11
213	0.12
214	0.12
215	0.14
216	0.11
217	0.1
218	0.1
219	0.09
220	0.09
221	0.08
222	0.07
223	0.05
224	0.05
225	0.05
226	0.07
227	0.08
228	0.09
229	0.09
230	0.1
231	0.11
232	0.1
233	0.11
234	0.09
235	0.12
236	0.11
237	0.11
238	0.1
239	0.09
240	0.1
241	0.09
242	0.08
243	0.05
244	0.04
245	0.04
246	0.04
247	0.04
248	0.04
249	0.04
250	0.06
251	0.06
252	0.06
253	0.07
254	0.07
255	0.06
256	0.06
257	0.06
258	0.05
259	0.07
260	0.07
261	0.06
262	0.06
263	0.07
264	0.07
265	0.08
266	0.09
267	0.07
268	0.12
269	0.12
270	0.12
271	0.12
272	0.12
273	0.12
274	0.18
275	0.18
276	0.14
277	0.14
278	0.16
279	0.17
280	0.17
281	0.17
282	0.13
283	0.13
284	0.14
285	0.17
286	0.14
287	0.14
288	0.13
289	0.12
290	0.11
291	0.11
292	0.11
293	0.09
294	0.14
295	0.17
296	0.18
297	0.23
298	0.25
299	0.31
300	0.34
301	0.34
302	0.35
303	0.33
304	0.38
305	0.34
306	0.31
307	0.26
308	0.21
309	0.21
310	0.14
311	0.14
312	0.09
313	0.08
314	0.06
315	0.08
316	0.1
317	0.09
318	0.1
319	0.1
320	0.09
321	0.1
322	0.11
323	0.11
324	0.12
325	0.13
326	0.14
327	0.14
328	0.15
329	0.16
330	0.14
331	0.12
332	0.1
333	0.11
334	0.11
335	0.12
336	0.11
337	0.1
338	0.11
339	0.11
340	0.1
341	0.09
342	0.07
343	0.07
344	0.07
345	0.06
346	0.07
347	0.09
348	0.09
349	0.09
350	0.08
351	0.09
352	0.1
353	0.1
354	0.09
355	0.09
356	0.08
357	0.09
358	0.08
359	0.07
360	0.06
361	0.06
362	0.05
363	0.04
364	0.05
365	0.05
366	0.07
367	0.09
368	0.13
369	0.13
370	0.13
371	0.14
372	0.17
373	0.18
374	0.17
375	0.18
376	0.15
377	0.17
378	0.18
379	0.17
380	0.13
381	0.12
382	0.12
383	0.09
384	0.08
385	0.06
386	0.05
387	0.08
388	0.08
389	0.08
390	0.09
391	0.09
392	0.09
393	0.09
394	0.11
395	0.12
396	0.11
397	0.11
398	0.1
399	0.12
400	0.12
401	0.14
402	0.13
403	0.12
404	0.2
405	0.28
406	0.32
407	0.35
408	0.38
409	0.41
410	0.48
411	0.52
412	0.53
413	0.55
414	0.6
415	0.57
416	0.58
417	0.59
418	0.53
419	0.47
420	0.42
421	0.33
422	0.28
423	0.31
424	0.27
425	0.22
426	0.23
427	0.24
428	0.22
429	0.21
430	0.19
431	0.18
432	0.18
433	0.22
434	0.2
435	0.23
436	0.28
437	0.33
438	0.36
439	0.39
440	0.4
441	0.41
442	0.47
443	0.44
444	0.37
445	0.32
446	0.32
447	0.32
448	0.33
449	0.35
450	0.31
451	0.32
452	0.35
453	0.35
454	0.33
455	0.29
456	0.3
457	0.24
458	0.22
459	0.24
460	0.21
461	0.23
462	0.24
463	0.25
464	0.23
465	0.23
466	0.25
467	0.22
468	0.24
469	0.24
470	0.25

M2V9B3

3D AlphaFold-predicted Structure Viewer