Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2T7E5

Protein Details
Accession M2T7E5    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
93-112LDEARRKRVRRTRGELQERWBasic
NLS Segment(s)
PositionSequence
99-100KR
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, cyto 4.5, mito 4
Family & Domain DBs
Amino Acid Sequences MGGGQAGGQAGKQASKLHRHEQQVEMTVRVSVCVCAAGAGTDAGAGAAAASASKQAGRQATPTTPEGRARAGLGKQQLAVVRGGSGWAESTTLDEARRKRVRRTRGELQERWTWLVRGTGSPAQPDSPGPKGSALEGPHAFPSADLCICSRHGTGGRTGGGTGGGTGEGTGTGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.32
3 0.38
4 0.44
5 0.51
6 0.56
7 0.6
8 0.59
9 0.59
10 0.57
11 0.53
12 0.45
13 0.38
14 0.33
15 0.28
16 0.24
17 0.19
18 0.11
19 0.09
20 0.09
21 0.08
22 0.06
23 0.06
24 0.06
25 0.06
26 0.05
27 0.05
28 0.04
29 0.04
30 0.04
31 0.03
32 0.03
33 0.02
34 0.02
35 0.02
36 0.02
37 0.02
38 0.03
39 0.03
40 0.04
41 0.05
42 0.08
43 0.11
44 0.12
45 0.15
46 0.18
47 0.19
48 0.22
49 0.24
50 0.23
51 0.23
52 0.25
53 0.24
54 0.22
55 0.21
56 0.19
57 0.2
58 0.19
59 0.2
60 0.19
61 0.18
62 0.17
63 0.18
64 0.18
65 0.16
66 0.15
67 0.11
68 0.09
69 0.08
70 0.08
71 0.06
72 0.05
73 0.04
74 0.04
75 0.04
76 0.04
77 0.05
78 0.06
79 0.07
80 0.08
81 0.12
82 0.13
83 0.23
84 0.3
85 0.32
86 0.41
87 0.49
88 0.58
89 0.64
90 0.71
91 0.71
92 0.75
93 0.81
94 0.75
95 0.71
96 0.66
97 0.58
98 0.53
99 0.43
100 0.33
101 0.25
102 0.24
103 0.2
104 0.16
105 0.19
106 0.2
107 0.2
108 0.21
109 0.21
110 0.19
111 0.19
112 0.2
113 0.2
114 0.19
115 0.19
116 0.19
117 0.19
118 0.19
119 0.2
120 0.23
121 0.2
122 0.22
123 0.22
124 0.23
125 0.22
126 0.22
127 0.2
128 0.15
129 0.16
130 0.14
131 0.13
132 0.13
133 0.13
134 0.14
135 0.16
136 0.19
137 0.17
138 0.19
139 0.22
140 0.23
141 0.27
142 0.3
143 0.29
144 0.27
145 0.27
146 0.22
147 0.19
148 0.17
149 0.13
150 0.08
151 0.07
152 0.06
153 0.06
154 0.06