Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2URV3

Protein Details
Accession M2URV3    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
134-161GDAEKPTTKPAKKPKKKAKAVKLTFGDEHydrophilic
NLS Segment(s)
PositionSequence
113-117KKRKA
139-153PTTKPAKKPKKKAKA
Subcellular Location(s) nucl 21, cyto_nucl 13.333, mito_nucl 11.333, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MSFKAKDLQFDSSQPAFLQRLRGQLQSGDTARHEHPIARNKRMNKDDDEDDAPTYVLEDTNQSLSKEEYDALVSGKDSKGEEDSVTDEAGQKATKQDESKPKDKIAEVGANTKKRKAAKIIGDDQGDGRSEIEGDAEKPTTKPAKKPKKKAKAVKLTFGDEDEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.26
4 0.25
5 0.31
6 0.26
7 0.33
8 0.35
9 0.37
10 0.34
11 0.34
12 0.35
13 0.33
14 0.31
15 0.26
16 0.24
17 0.26
18 0.26
19 0.26
20 0.25
21 0.22
22 0.29
23 0.37
24 0.43
25 0.47
26 0.53
27 0.56
28 0.65
29 0.66
30 0.63
31 0.59
32 0.57
33 0.51
34 0.5
35 0.46
36 0.38
37 0.33
38 0.28
39 0.22
40 0.17
41 0.14
42 0.1
43 0.07
44 0.06
45 0.06
46 0.07
47 0.1
48 0.11
49 0.11
50 0.11
51 0.12
52 0.12
53 0.12
54 0.11
55 0.09
56 0.08
57 0.08
58 0.08
59 0.07
60 0.07
61 0.08
62 0.07
63 0.08
64 0.08
65 0.08
66 0.09
67 0.09
68 0.09
69 0.09
70 0.1
71 0.1
72 0.1
73 0.09
74 0.09
75 0.08
76 0.09
77 0.08
78 0.07
79 0.08
80 0.1
81 0.13
82 0.14
83 0.21
84 0.31
85 0.38
86 0.43
87 0.44
88 0.45
89 0.45
90 0.43
91 0.39
92 0.34
93 0.33
94 0.29
95 0.34
96 0.38
97 0.42
98 0.43
99 0.42
100 0.42
101 0.4
102 0.43
103 0.41
104 0.44
105 0.45
106 0.53
107 0.56
108 0.57
109 0.54
110 0.5
111 0.44
112 0.36
113 0.28
114 0.2
115 0.14
116 0.09
117 0.09
118 0.08
119 0.09
120 0.08
121 0.09
122 0.11
123 0.12
124 0.12
125 0.12
126 0.19
127 0.27
128 0.3
129 0.39
130 0.47
131 0.58
132 0.68
133 0.79
134 0.84
135 0.86
136 0.93
137 0.94
138 0.94
139 0.94
140 0.9
141 0.89
142 0.83
143 0.77
144 0.68