Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2UGE5

Protein Details
Accession M2UGE5    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
15-35LGLPRPHPNRPQHDRPTLPRFHydrophilic
176-195TKNLKFPLPHRINKKAGKKVHydrophilic
NLS Segment(s)
PositionSequence
189-193KKAGK
Subcellular Location(s) nucl 10, mito 10, mito_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR028877  50S_L18Ae/Ribosomal_L18a/L20  
IPR023573  Ribosomal_L18a//L18Ae/LX  
IPR021138  Ribosomal_L18a/L20_eukaryotes  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01775  Ribosomal_L18A  
Amino Acid Sequences MMALDEKLRTCMRLLGLPRPHPNRPQHDRPTLPRFQEYQIIGRHLPSEANPAPKIYRMRIFAPNEVVAKSRFWYFLGKLRKIKKANGEIVSVNQIHEKKPQKVKNFGIWIKYDSRSGTHNMYKEYREMSRVAAVEALYQDMAARHRTRFRSVQILKVVEVEKADDLRRPYIKQLLTKNLKFPLPHRINKKAGKKVFAAHRPSTFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.35
3 0.43
4 0.49
5 0.58
6 0.6
7 0.64
8 0.66
9 0.71
10 0.72
11 0.73
12 0.76
13 0.76
14 0.79
15 0.8
16 0.8
17 0.79
18 0.76
19 0.71
20 0.65
21 0.59
22 0.52
23 0.51
24 0.45
25 0.42
26 0.38
27 0.38
28 0.34
29 0.31
30 0.29
31 0.23
32 0.21
33 0.17
34 0.21
35 0.21
36 0.26
37 0.25
38 0.26
39 0.27
40 0.31
41 0.34
42 0.3
43 0.32
44 0.3
45 0.34
46 0.4
47 0.43
48 0.41
49 0.41
50 0.39
51 0.34
52 0.32
53 0.29
54 0.21
55 0.19
56 0.17
57 0.15
58 0.13
59 0.13
60 0.16
61 0.17
62 0.24
63 0.31
64 0.36
65 0.42
66 0.47
67 0.54
68 0.54
69 0.57
70 0.58
71 0.57
72 0.58
73 0.54
74 0.5
75 0.42
76 0.4
77 0.38
78 0.29
79 0.21
80 0.18
81 0.16
82 0.15
83 0.22
84 0.27
85 0.3
86 0.4
87 0.46
88 0.49
89 0.56
90 0.59
91 0.58
92 0.61
93 0.56
94 0.5
95 0.44
96 0.41
97 0.36
98 0.34
99 0.28
100 0.2
101 0.19
102 0.18
103 0.19
104 0.22
105 0.22
106 0.23
107 0.25
108 0.27
109 0.27
110 0.27
111 0.27
112 0.23
113 0.21
114 0.2
115 0.18
116 0.19
117 0.18
118 0.16
119 0.15
120 0.14
121 0.12
122 0.12
123 0.11
124 0.07
125 0.06
126 0.06
127 0.06
128 0.08
129 0.12
130 0.14
131 0.17
132 0.24
133 0.28
134 0.33
135 0.37
136 0.4
137 0.46
138 0.46
139 0.5
140 0.5
141 0.48
142 0.43
143 0.41
144 0.38
145 0.28
146 0.26
147 0.2
148 0.15
149 0.16
150 0.17
151 0.16
152 0.19
153 0.24
154 0.27
155 0.28
156 0.31
157 0.37
158 0.41
159 0.44
160 0.49
161 0.53
162 0.59
163 0.6
164 0.61
165 0.58
166 0.57
167 0.52
168 0.47
169 0.47
170 0.47
171 0.52
172 0.55
173 0.6
174 0.65
175 0.72
176 0.8
177 0.79
178 0.77
179 0.74
180 0.69
181 0.69
182 0.7
183 0.69
184 0.67
185 0.63