Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2SQ36

Protein Details
Accession M2SQ36   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
63-82KARNLENKRRREERERLREMBasic
NLS Segment(s)
PositionSequence
64-77ARNLENKRRREERE
Subcellular Location(s) cyto 11.5, cyto_nucl 10, nucl 7.5, mito 4, cysk 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018625  Pet100  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
Pfam View protein in Pfam  
PF09803  Pet100  
Amino Acid Sequences MGGPNLEVFKFGMYILFPISVMYYFGTNLDGKFTVPDFWPKPGQTHKIPYDRDEIAKELERIKARNLENKRRREERERLREMGGQTREE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.08
5 0.08
6 0.09
7 0.08
8 0.08
9 0.08
10 0.07
11 0.07
12 0.07
13 0.09
14 0.09
15 0.09
16 0.1
17 0.1
18 0.1
19 0.11
20 0.11
21 0.1
22 0.11
23 0.17
24 0.17
25 0.19
26 0.23
27 0.22
28 0.26
29 0.3
30 0.34
31 0.31
32 0.37
33 0.4
34 0.44
35 0.44
36 0.43
37 0.42
38 0.38
39 0.37
40 0.31
41 0.26
42 0.22
43 0.24
44 0.23
45 0.2
46 0.24
47 0.25
48 0.24
49 0.26
50 0.31
51 0.31
52 0.39
53 0.47
54 0.53
55 0.59
56 0.67
57 0.72
58 0.73
59 0.78
60 0.78
61 0.8
62 0.8
63 0.82
64 0.79
65 0.74
66 0.7
67 0.67
68 0.61
69 0.6