Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2V7K0

Protein Details
Accession M2V7K0    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
68-98CEFHYKQRNREEEERKKKKEEEEESKKKELKBasic
NLS Segment(s)
PositionSequence
80-103EERKKKKEEEEESKKKELKDRERE
Subcellular Location(s) nucl 15, mito 11
Family & Domain DBs
Amino Acid Sequences MCKRYPLECAMPNCLNTIPPHYIWGESCYQATTHDRGVKRHYIPGVKPSGYCGFTQVMEPYKHPYMLCEFHYKQRNREEEERKKKKEEEEESKKKELKDREREGIPRGMGHLID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.31
3 0.26
4 0.28
5 0.24
6 0.22
7 0.24
8 0.22
9 0.23
10 0.22
11 0.24
12 0.21
13 0.18
14 0.18
15 0.16
16 0.15
17 0.17
18 0.19
19 0.18
20 0.21
21 0.26
22 0.28
23 0.3
24 0.36
25 0.4
26 0.39
27 0.41
28 0.4
29 0.39
30 0.39
31 0.42
32 0.42
33 0.35
34 0.33
35 0.32
36 0.31
37 0.27
38 0.26
39 0.21
40 0.17
41 0.16
42 0.17
43 0.15
44 0.15
45 0.15
46 0.16
47 0.18
48 0.18
49 0.19
50 0.18
51 0.18
52 0.18
53 0.2
54 0.22
55 0.26
56 0.27
57 0.33
58 0.43
59 0.44
60 0.46
61 0.52
62 0.55
63 0.54
64 0.62
65 0.66
66 0.68
67 0.76
68 0.8
69 0.77
70 0.77
71 0.75
72 0.73
73 0.73
74 0.72
75 0.72
76 0.72
77 0.78
78 0.78
79 0.8
80 0.76
81 0.69
82 0.67
83 0.66
84 0.66
85 0.66
86 0.68
87 0.68
88 0.71
89 0.72
90 0.69
91 0.65
92 0.56
93 0.46
94 0.41