Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2TWP7

Protein Details
Accession M2TWP7   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-27NSQPLLRRPPTQRRRSSSPRCSTKTIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences ANSQPLLRRPPTQRRRSSSPRCSTKTIFSNAVLNGRRRPSATRWRLNDTSILASKYKHPIIPLIGLSDPIAFVNDLGPAYKTYLPTPLTRTVQQLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.83
3 0.86
4 0.87
5 0.87
6 0.86
7 0.86
8 0.81
9 0.79
10 0.73
11 0.7
12 0.65
13 0.59
14 0.52
15 0.43
16 0.42
17 0.37
18 0.4
19 0.36
20 0.32
21 0.32
22 0.31
23 0.31
24 0.29
25 0.32
26 0.33
27 0.4
28 0.47
29 0.5
30 0.52
31 0.58
32 0.57
33 0.54
34 0.48
35 0.39
36 0.33
37 0.26
38 0.24
39 0.17
40 0.16
41 0.18
42 0.21
43 0.21
44 0.19
45 0.18
46 0.19
47 0.21
48 0.23
49 0.21
50 0.18
51 0.16
52 0.16
53 0.16
54 0.13
55 0.11
56 0.08
57 0.08
58 0.06
59 0.06
60 0.06
61 0.06
62 0.07
63 0.07
64 0.08
65 0.08
66 0.12
67 0.14
68 0.15
69 0.15
70 0.22
71 0.23
72 0.26
73 0.3
74 0.35
75 0.37
76 0.38