Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2V9E1

Protein Details
Accession M2V9E1   
Localization Confidence Low
Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
38-61SLHLNRDKAFHRQRRRVWDNGMKEHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 13, nucl 5, cyto 5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001128  Cyt_P450  
IPR002401  Cyt_P450_E_grp-I  
IPR036396  Cyt_P450_sf  
Gene Ontology GO:0020037  F:heme binding  
GO:0005506  F:iron ion binding  
GO:0004497  F:monooxygenase activity  
GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
Pfam View protein in Pfam  
PF00067  p450  
CDD cd11061  CYP67-like  
Amino Acid Sequences MAIGPREISIYDPSAIQPILGFSSMTTKGPFYDVMEKSLHLNRDKAFHRQRRRVWDNGMKESLSTFSPLVEEFTDKLLAQLHKQNGEPIELWRYCSYYSYDVMSKLAFGESMGFVEGKQSEVAASILNTFNSSLSAMGLMYHVPWLMNTLGVVTSIAGPMKEWRDWSVSQMKQRIARTDGRTDFVGHLIKNTPNDTAGLDLLYGESRLIIGAGSETTSSALTFTLMQLATNPKYVDAIRKEFRDCVSFDCQRPLPMLDAVIQESMRLWPSIFFAPQRVTPPSGLHINSHFIPGNTIIQMPPFATFRDPRNFVKPDEFLPERWTSEPELVLNKHAFIPFSTGPYNCVGKTLANMELRSVIARVVNEFDIRLPDGFVAEQYWESIKDQFTAAPPESQRVSFVKCQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.17
4 0.13
5 0.12
6 0.13
7 0.13
8 0.12
9 0.09
10 0.15
11 0.17
12 0.18
13 0.18
14 0.17
15 0.17
16 0.2
17 0.21
18 0.19
19 0.27
20 0.27
21 0.29
22 0.3
23 0.29
24 0.32
25 0.36
26 0.37
27 0.31
28 0.34
29 0.33
30 0.4
31 0.42
32 0.48
33 0.54
34 0.58
35 0.66
36 0.72
37 0.78
38 0.81
39 0.85
40 0.82
41 0.81
42 0.8
43 0.77
44 0.75
45 0.7
46 0.59
47 0.52
48 0.46
49 0.37
50 0.28
51 0.22
52 0.14
53 0.11
54 0.12
55 0.12
56 0.13
57 0.13
58 0.14
59 0.12
60 0.14
61 0.15
62 0.14
63 0.15
64 0.19
65 0.19
66 0.21
67 0.27
68 0.3
69 0.31
70 0.32
71 0.35
72 0.31
73 0.33
74 0.29
75 0.25
76 0.29
77 0.26
78 0.29
79 0.26
80 0.26
81 0.23
82 0.25
83 0.25
84 0.2
85 0.21
86 0.2
87 0.21
88 0.2
89 0.21
90 0.19
91 0.16
92 0.13
93 0.12
94 0.08
95 0.07
96 0.08
97 0.07
98 0.07
99 0.08
100 0.07
101 0.07
102 0.09
103 0.09
104 0.08
105 0.08
106 0.08
107 0.07
108 0.08
109 0.08
110 0.06
111 0.06
112 0.08
113 0.08
114 0.09
115 0.09
116 0.08
117 0.08
118 0.08
119 0.08
120 0.06
121 0.06
122 0.06
123 0.05
124 0.05
125 0.06
126 0.05
127 0.05
128 0.05
129 0.05
130 0.05
131 0.05
132 0.06
133 0.06
134 0.06
135 0.06
136 0.06
137 0.06
138 0.06
139 0.06
140 0.04
141 0.05
142 0.05
143 0.05
144 0.05
145 0.05
146 0.08
147 0.11
148 0.12
149 0.12
150 0.14
151 0.18
152 0.18
153 0.23
154 0.29
155 0.31
156 0.35
157 0.39
158 0.4
159 0.42
160 0.43
161 0.42
162 0.37
163 0.41
164 0.39
165 0.42
166 0.41
167 0.37
168 0.36
169 0.33
170 0.3
171 0.25
172 0.23
173 0.15
174 0.15
175 0.16
176 0.17
177 0.17
178 0.17
179 0.15
180 0.13
181 0.13
182 0.12
183 0.1
184 0.09
185 0.07
186 0.06
187 0.05
188 0.05
189 0.05
190 0.04
191 0.03
192 0.03
193 0.03
194 0.03
195 0.03
196 0.02
197 0.02
198 0.03
199 0.03
200 0.03
201 0.03
202 0.04
203 0.04
204 0.04
205 0.04
206 0.04
207 0.04
208 0.05
209 0.05
210 0.05
211 0.07
212 0.07
213 0.07
214 0.08
215 0.12
216 0.13
217 0.15
218 0.15
219 0.12
220 0.14
221 0.15
222 0.2
223 0.21
224 0.27
225 0.28
226 0.31
227 0.33
228 0.33
229 0.34
230 0.3
231 0.26
232 0.24
233 0.28
234 0.3
235 0.3
236 0.33
237 0.32
238 0.3
239 0.31
240 0.27
241 0.21
242 0.17
243 0.17
244 0.14
245 0.14
246 0.14
247 0.14
248 0.12
249 0.1
250 0.1
251 0.1
252 0.09
253 0.08
254 0.07
255 0.07
256 0.1
257 0.12
258 0.13
259 0.13
260 0.15
261 0.17
262 0.19
263 0.22
264 0.23
265 0.23
266 0.23
267 0.24
268 0.24
269 0.27
270 0.26
271 0.24
272 0.23
273 0.24
274 0.23
275 0.24
276 0.22
277 0.17
278 0.18
279 0.17
280 0.17
281 0.15
282 0.15
283 0.12
284 0.12
285 0.12
286 0.11
287 0.11
288 0.1
289 0.1
290 0.14
291 0.17
292 0.23
293 0.3
294 0.35
295 0.37
296 0.45
297 0.46
298 0.45
299 0.48
300 0.44
301 0.38
302 0.42
303 0.4
304 0.33
305 0.35
306 0.35
307 0.31
308 0.31
309 0.3
310 0.25
311 0.25
312 0.26
313 0.23
314 0.26
315 0.24
316 0.27
317 0.26
318 0.24
319 0.25
320 0.24
321 0.22
322 0.17
323 0.23
324 0.2
325 0.23
326 0.25
327 0.22
328 0.24
329 0.27
330 0.29
331 0.22
332 0.23
333 0.2
334 0.18
335 0.2
336 0.21
337 0.24
338 0.25
339 0.25
340 0.25
341 0.25
342 0.25
343 0.23
344 0.2
345 0.15
346 0.13
347 0.14
348 0.14
349 0.16
350 0.17
351 0.17
352 0.17
353 0.17
354 0.18
355 0.19
356 0.18
357 0.15
358 0.14
359 0.14
360 0.14
361 0.13
362 0.11
363 0.11
364 0.11
365 0.12
366 0.13
367 0.13
368 0.14
369 0.18
370 0.18
371 0.18
372 0.19
373 0.2
374 0.22
375 0.27
376 0.28
377 0.31
378 0.31
379 0.35
380 0.36
381 0.34
382 0.35
383 0.32
384 0.37