Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2TZL1

Protein Details
Accession M2TZL1    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
98-124KVKAREKSKKKASAAKKSKRKYRALEEBasic
NLS Segment(s)
PositionSequence
97-120TKVKAREKSKKKASAAKKSKRKYR
Subcellular Location(s) cyto_nucl 12.5, nucl 11, mito 10, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
IPR045853  Pep_chain_release_fac_I_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003747  F:translation release factor activity  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences MCIQHAAFHNTPALFPKALPPRPVLDESDLIENFLKGSGPGGQKINKTSSAVQLKHIPTGIVVKYQDTRSREINRKMARRILQDRIEELELGEDARTKVKAREKSKKKASAAKKSKRKYRALEEAKQSGKEDASTDVDAGLKGVEGEAAAPDLVRGGDVSKAAGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.27
4 0.33
5 0.37
6 0.39
7 0.38
8 0.39
9 0.43
10 0.46
11 0.41
12 0.35
13 0.33
14 0.32
15 0.35
16 0.3
17 0.26
18 0.24
19 0.2
20 0.16
21 0.14
22 0.12
23 0.06
24 0.07
25 0.12
26 0.13
27 0.16
28 0.2
29 0.24
30 0.26
31 0.3
32 0.32
33 0.28
34 0.29
35 0.28
36 0.33
37 0.38
38 0.36
39 0.35
40 0.39
41 0.38
42 0.37
43 0.35
44 0.26
45 0.19
46 0.22
47 0.2
48 0.16
49 0.15
50 0.15
51 0.18
52 0.2
53 0.25
54 0.23
55 0.25
56 0.28
57 0.36
58 0.43
59 0.46
60 0.52
61 0.54
62 0.58
63 0.58
64 0.58
65 0.54
66 0.54
67 0.53
68 0.51
69 0.49
70 0.44
71 0.42
72 0.38
73 0.34
74 0.26
75 0.21
76 0.14
77 0.09
78 0.08
79 0.07
80 0.05
81 0.05
82 0.07
83 0.08
84 0.08
85 0.14
86 0.21
87 0.3
88 0.39
89 0.49
90 0.57
91 0.67
92 0.76
93 0.79
94 0.77
95 0.78
96 0.79
97 0.8
98 0.82
99 0.82
100 0.82
101 0.82
102 0.86
103 0.85
104 0.84
105 0.81
106 0.79
107 0.8
108 0.78
109 0.77
110 0.75
111 0.73
112 0.67
113 0.61
114 0.53
115 0.43
116 0.35
117 0.28
118 0.23
119 0.18
120 0.19
121 0.18
122 0.17
123 0.16
124 0.16
125 0.14
126 0.13
127 0.1
128 0.06
129 0.05
130 0.05
131 0.04
132 0.04
133 0.04
134 0.04
135 0.05
136 0.05
137 0.05
138 0.05
139 0.06
140 0.06
141 0.05
142 0.05
143 0.06
144 0.08
145 0.09