Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2UNV6

Protein Details
Accession M2UNV6    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
8-28IEPPAVKKRGRPKKVAEDAGEBasic
NLS Segment(s)
PositionSequence
14-21KKRGRPKK
35-67KKTPAVKKATTKPIAPKDKLIAPEKDKKTIAKK
Subcellular Location(s) nucl 15, cyto 5, mito 4, plas 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSSTNTTIEPPAVKKRGRPKKVAEDAGETIVVEAKKTPAVKKATTKPIAPKDKLIAPEKDKKTIAKKNAPEHLTPVTPATSKILESVRAKGTLSKTLPTKTASLESRNSGTPPATTAQAPPISSSSPPPPPQQQQQPKTPRTHPAPTTIPLPQKPIPAPSPISSASHTTSPRNPVLPPNPYPSTPRRIPPALSQHTRVIEPTPDIRLPPKYKPAARRVTAIIVSLPIVLVFGYELLERWRGKKEVKVKFGGDRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.57
3 0.65
4 0.69
5 0.73
6 0.73
7 0.76
8 0.84
9 0.84
10 0.77
11 0.72
12 0.66
13 0.59
14 0.49
15 0.38
16 0.28
17 0.24
18 0.2
19 0.13
20 0.12
21 0.11
22 0.15
23 0.19
24 0.21
25 0.25
26 0.31
27 0.37
28 0.45
29 0.53
30 0.6
31 0.61
32 0.63
33 0.65
34 0.69
35 0.73
36 0.66
37 0.61
38 0.55
39 0.56
40 0.57
41 0.53
42 0.5
43 0.47
44 0.55
45 0.54
46 0.55
47 0.52
48 0.52
49 0.57
50 0.58
51 0.61
52 0.61
53 0.65
54 0.67
55 0.73
56 0.7
57 0.61
58 0.57
59 0.5
60 0.41
61 0.34
62 0.28
63 0.21
64 0.18
65 0.18
66 0.16
67 0.13
68 0.13
69 0.15
70 0.15
71 0.19
72 0.2
73 0.23
74 0.23
75 0.23
76 0.23
77 0.24
78 0.25
79 0.27
80 0.27
81 0.26
82 0.27
83 0.28
84 0.3
85 0.27
86 0.26
87 0.21
88 0.25
89 0.24
90 0.25
91 0.25
92 0.25
93 0.25
94 0.25
95 0.23
96 0.19
97 0.17
98 0.13
99 0.12
100 0.12
101 0.11
102 0.1
103 0.1
104 0.13
105 0.14
106 0.14
107 0.13
108 0.13
109 0.13
110 0.13
111 0.15
112 0.15
113 0.18
114 0.21
115 0.23
116 0.27
117 0.3
118 0.35
119 0.44
120 0.5
121 0.5
122 0.57
123 0.63
124 0.64
125 0.65
126 0.63
127 0.6
128 0.57
129 0.59
130 0.51
131 0.48
132 0.46
133 0.42
134 0.41
135 0.38
136 0.37
137 0.31
138 0.35
139 0.31
140 0.31
141 0.3
142 0.32
143 0.29
144 0.28
145 0.3
146 0.25
147 0.27
148 0.24
149 0.25
150 0.22
151 0.23
152 0.21
153 0.23
154 0.23
155 0.23
156 0.26
157 0.29
158 0.3
159 0.29
160 0.28
161 0.32
162 0.37
163 0.4
164 0.39
165 0.41
166 0.41
167 0.41
168 0.45
169 0.42
170 0.44
171 0.41
172 0.42
173 0.42
174 0.42
175 0.44
176 0.46
177 0.52
178 0.52
179 0.53
180 0.52
181 0.51
182 0.49
183 0.47
184 0.4
185 0.32
186 0.26
187 0.25
188 0.24
189 0.24
190 0.23
191 0.24
192 0.27
193 0.33
194 0.35
195 0.39
196 0.45
197 0.49
198 0.55
199 0.63
200 0.69
201 0.7
202 0.67
203 0.65
204 0.6
205 0.57
206 0.51
207 0.43
208 0.34
209 0.25
210 0.23
211 0.18
212 0.14
213 0.08
214 0.07
215 0.06
216 0.05
217 0.04
218 0.04
219 0.05
220 0.05
221 0.06
222 0.09
223 0.15
224 0.16
225 0.19
226 0.25
227 0.29
228 0.34
229 0.42
230 0.5
231 0.55
232 0.61
233 0.66
234 0.64