Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2UFK9

Protein Details
Accession M2UFK9    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
126-157ASTEAQKKRKRNADASKRFRAKRDERNREMKMHydrophilic
NLS Segment(s)
PositionSequence
132-154KKRKRNADASKRFRAKRDERNRE
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
PROSITE View protein in PROSITE  
PS00036  BZIP_BASIC  
Amino Acid Sequences MIANLVPNQDEQTPLGGGSITSELPYSQRASNQPIPPPFLAECKNEFRHTSTNPPLSVHNRGIAQTPSDKKGGDMLAQTMQCPIRARIEIKKTECVSSSQGGESSVVRLRNKNGNEYNIPADTKIASTEAQKKRKRNADASKRFRAKRDERNREMKMEIKRLEFQLGECKSDRDRYRNERNESILAHFPITITITEVIFCG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.11
4 0.1
5 0.1
6 0.11
7 0.09
8 0.08
9 0.09
10 0.09
11 0.1
12 0.13
13 0.14
14 0.14
15 0.19
16 0.23
17 0.31
18 0.39
19 0.43
20 0.48
21 0.48
22 0.51
23 0.47
24 0.46
25 0.39
26 0.36
27 0.35
28 0.31
29 0.33
30 0.35
31 0.39
32 0.38
33 0.39
34 0.38
35 0.41
36 0.41
37 0.45
38 0.46
39 0.47
40 0.44
41 0.44
42 0.44
43 0.42
44 0.45
45 0.37
46 0.32
47 0.28
48 0.28
49 0.29
50 0.25
51 0.22
52 0.23
53 0.25
54 0.24
55 0.25
56 0.24
57 0.21
58 0.24
59 0.23
60 0.18
61 0.16
62 0.15
63 0.18
64 0.18
65 0.17
66 0.16
67 0.15
68 0.15
69 0.16
70 0.16
71 0.15
72 0.17
73 0.2
74 0.25
75 0.32
76 0.36
77 0.37
78 0.43
79 0.4
80 0.39
81 0.37
82 0.32
83 0.28
84 0.23
85 0.22
86 0.15
87 0.14
88 0.13
89 0.13
90 0.11
91 0.1
92 0.11
93 0.13
94 0.14
95 0.16
96 0.18
97 0.25
98 0.26
99 0.32
100 0.32
101 0.33
102 0.34
103 0.35
104 0.34
105 0.29
106 0.28
107 0.2
108 0.18
109 0.13
110 0.12
111 0.1
112 0.09
113 0.08
114 0.12
115 0.22
116 0.3
117 0.4
118 0.46
119 0.52
120 0.6
121 0.68
122 0.71
123 0.71
124 0.74
125 0.76
126 0.8
127 0.82
128 0.84
129 0.83
130 0.79
131 0.74
132 0.73
133 0.71
134 0.71
135 0.74
136 0.75
137 0.74
138 0.82
139 0.79
140 0.73
141 0.67
142 0.62
143 0.59
144 0.57
145 0.53
146 0.47
147 0.47
148 0.45
149 0.45
150 0.39
151 0.32
152 0.33
153 0.31
154 0.3
155 0.28
156 0.29
157 0.29
158 0.37
159 0.42
160 0.4
161 0.48
162 0.54
163 0.64
164 0.71
165 0.75
166 0.72
167 0.71
168 0.68
169 0.61
170 0.56
171 0.51
172 0.42
173 0.36
174 0.3
175 0.25
176 0.22
177 0.21
178 0.16
179 0.13
180 0.12
181 0.12